REPEAT (org=dred0&id=ABO49029.1)

>ABO49029.1 dred0 ABO49029.1 GIB00494CH01 "protein of unknown function DUF1540"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        128
#NPREPATH      1
#NNOVPATH      1
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1     4 ->    53 type S Sc  132 SqID  43.5 Zsc  13.7
#SEGMENT  2    83 ->   128 type M Sc  324 SqID 100.0 Zsc  40.7
#ALIGNMENT
1       4:SPRVLCEVNTCTHWLLGNLCTAANIDILYEEEGKMAQKDAHTECKTFYKK:   53
2      83:TPAVVCIVESCKYWAKGNLCEAETIQV----SGQNANECQDTNCKTFEEK:  128
         :.*.*.*.*..*..*..****.*..*..    .*..*.....*.****..*


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
                           :                          +               |128 aa
 111111111111111111111111111                22222222222222222222222222|#1|2 seg
//