REPEAT (org=dred0&id=ABO49594.1)

>ABO49594.1 dred0 ABO49594.1 GIB00494CH01 "putative sporulation protein"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        128
#NPREPATH      1
#NNOVPATH      1
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1     3 ->    54 type M Sc  317 SqID 100.0 Zsc  38.9
#SEGMENT  2    71 ->   123 type S Sc   60 SqID  28.8 Zsc   3.4
#ALIGNMENT
1       3:ILQIVGLGLVVCILAIILRQQ-KPPMATLLTMTAGIIIFFAMMSQITAVFNVL:   54
2      71:ILKIVGIAYIADFGSQICRDAGESALASKIEFAAKIIVLVMAVPIIVAVLQSL:  123
         :**.***..........*.*.. ....*......*.**........*.**...*


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
                           :                          +               |128 aa
 1111111111111111111111111111         22222222222222222222222222222   |#1|2 seg
//