REPEAT (org=dred0&id=ABO49955.1)

>ABO49955.1 dred0 ABO49955.1 GIB00494CH01 "protein of unknown function DUF81"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        426
#NPREPATH      1
#NNOVPATH      1
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1    97 ->   187 type S Sc  105 SqID  32.1 Zsc   5.7
#SEGMENT  2   266 ->   353 type M Sc  546 SqID 100.0 Zsc  52.4
#ALIGNMENT
1      97:FVITPALM-SLGVKGILAVGTDQFHIFAKAIMGTVIHKKL-GNVNVALAIAFLVGSGIGV:  154
2     266:FLTFPMFVYGLGVSSFTTVGTDILQIIFTAGYSSIAQYAVYGYIFYTLAMGMLVGSLLGI:  325
         :*...*.....***.....****...*...*...........*.....**...****..*.

1     155:TAGGTLNRALFNMNPVLSDFIISLVYVV--MLGFL:  187
2     326:QIGAATTK-------VVSGIYIRAFYAIAIMAGFV:  353
         :..*.....       *.*...*...*....*.**.


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
        :       +       :       +        :       +       :       +    |426 aa
               111111111111111             22222222222222             |#1|2 seg
//