REPEAT (org=paer1&id=AAL63787.1)

>AAL63787.1 paer1 AAL63787.1 GIB00076CH01 "conserved protein with 2 CBS domains"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        142
#NPREPATH      1
#NNOVPATH      1
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1     6 ->    56 type S Sc   78 SqID  28.6 Zsc   5.8
#SEGMENT  2    71 ->   119 type M Sc  319 SqID 100.0 Zsc  38.9
#ALIGNMENT
1       6:IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIR:   56
2      71:IMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQ--IFGVISIRDLLK:  119
         :*....*............*.**...**....*.....  ..****.**...


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
                        :                        +                    |142 aa
  1111111111111111111111111       222222222222222222222222            |#1|2 seg
//