REPEAT (org=pubi0&id=AAZ20988.1)

>AAZ20988.1 pubi0 AAZ20988.1 GIB00256CH01 "membrane protein"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        215
#NPREPATH      1
#NNOVPATH      1
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1    46 ->   104 type S Sc   82 SqID  32.2 Zsc   5.2
#SEGMENT  2   142 ->   200 type M Sc  380 SqID 100.0 Zsc  42.4
#ALIGNMENT
1      46:IVSFAGASPWSILAQGIALNVDLSIGIITVLISIGVLFLWLPLKQKPGIGTILNAIIIG:  104
2     142:LVANLGAGPRDGLMVGLQKKTNLPIATVRAFLEITVMSIGWYLGGTVGIGTLLFAFGIG:  200
         :.*...**.*...*..*......*.*........*.*......*....****.*.*..**


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
                :               +               :                +    |215 aa
              1111111111111111111            2222222222222222222      |#1|2 seg
//