REPEAT (org=pubi0&id=AAZ21520.1)

>AAZ21520.1 pubi0 acrB GIB00256CH01 "probable integral membrane protein"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        794
#NPREPATH      1
#NNOVPATH      1
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1   161 ->   363 type M Sc 1301 SqID 100.0 Zsc 104.1
#SEGMENT  2   558 ->   764 type S Sc  131 SqID  25.4 Zsc   5.2
#ALIGNMENT
1     161:SGIIVYIKKD------ELKDIENKSAQEIEEYKDTLKKKNHENITQIREVIKTYGDVGK-:   -
2     558:SKIPETIKKDIIDPYISIKDNEARISLRIIDSQDGLRRNDL--INQINYDLENELKLSKE:  615
         :*.*...****      ..**.*......*....*.*.......*.**...........* 

1       -:-IYLGGIPMITDDMM-SFIKSDIIVFGLGVLLFIIATLWFIFRKLIWIIVPISSCFFSVL:  271
2     616:EFKLAGVLILFNNLLQSLFKSQILTLGL-VMVGIFAMFMILFRNFKLSLIGVVPNfiaaf:  674
         : ..*.*......... *..**.*...**.*...*.*.....**.................

1     272:IMTGLLGLLGWKVTVISSNFIALMLILTMAMNIHMSTRFLQLREDFPNL-DNLKIIIMTT:  330
2     675:filgiigllgiPLDMMtitiaaitigiaVDNSIHYIYRF---KEEFLKIKDYNKTLKVCH:  731
         :................................**...**....*.*... *..*......

1     331:SKMFWPIIYTVLTTICAFLSLVFSGIKPIIDFG:  363
2     732:STVGVAILNTSITIVFGFSILVFSKFIPTIYFG:  764
         :*.....*..*..*....*..****...*.*.**


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
    :   +    :   +    :   +   :    +   :    *   :   +    :   +    :   |794 aa
             111111111111111111                 222222222222222222    |#1|2 seg
//