REPEAT (org=pubi0&id=AAZ22111.1)

>AAZ22111.1 pubi0 AAZ22111.1 GIB00256CH01 "GXGXG motif-containing protein"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        284
#NPREPATH      3
#NNOVPATH      2
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1   101 ->   154 type S Sc   68 SqID  24.1 Zsc   3.1
#SEGMENT  2   158 ->   211 type M Sc  358 SqID 100.0 Zsc  38.3
#ALIGNMENT
1     101:NLIFEGSLGYFGMGSCDGPTVRINGRVGWSCAENLMAGKVVIEKNAGSCFGAAI:  154
2     158:DLICKGSVGARTGIDMKGGTIIVGGDAGAFTGFMMQRGRIIILGDVGINLGDSM:  211
         :.**..**.*........*.*....*..*.........*...*....*...*...


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
            :           +           :            +           :        |284 aa
                        1111111111111 2222222222222                   |#1|2 seg
//