REPEAT (org=rcon0&id=AAL03799.1)

>AAL03799.1 rcon0 AAL03799.1 GIB00062CH01 "cell surface antigen-like protein"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        652
#NPREPATH      1
#NNOVPATH      1
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1   338 ->   459 type M Sc  746 SqID 100.0 Zsc  64.7
#SEGMENT  2   485 ->   607 type S Sc  141 SqID  29.9 Zsc   7.6
#ALIGNMENT
1     338:NTGTLNVYTTGTILTATDSSIGMVNTINIGQGNA-VAAFTIDVSNKALTLGSD-INLNNT:  395
2     485:NTAVLNIAAGGVFADASLTS-AKIAKINIGEVNAGPAVYALDALNGDFPLDAPGVTFVNS:  543
         :**..**....*....*...*......****..** .*....*..*....*... ....*.

1     396:KSVFGLTTS----KNQQVTFMNSVDGFAGGGGSVNLSSTSSTIPNDNVLTLQGNLGNETL:  451
2     544:ASVLKLMTTVASGKNSTIELTGNIEPVVPNTGVVEINARNA----NTKLTIDGMANKYAI:  599
         :.**..*.*.    **................*.*..............**..*.......

1     452:GTKANPLA:  459
2     600:GTKANPVS:  607
         :******..


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
     :    +     :    +    :     +    :    +     :    *     :    +    :|652 aa
                                   1111111111111   2222222222222      |#1|2 seg
//