REPEAT (org=rpal2&id=ABE38049.1)

>ABE38049.1 rpal2 ABE38049.1 GIB00345CH01 "N/apple PAN precursor protein"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        184
#NPREPATH      1
#NNOVPATH      1
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1    31 ->    98 type M Sc  510 SqID 100.0 Zsc  58.8
#SEGMENT  2   114 ->   182 type S Sc  173 SqID  42.4 Zsc  16.6
#ALIGNMENT
1      31:NFDRPGADYLRAKVSSNDPAD-CALMCERDRRCRSWTFAYPQAPEDGAFCWLKSSV--PQ:   87
2     114:SIDRFGGDYRNFELKANEADDACKAACEQDNKCRAWTYARPGYVGRNARCFLKNQIKPPQ:  173
         :..**.*.**.......*...* *...**.*..**.**.*.*......*.*.**...  **

1      88:RSPSNCCVSGV:   98
2     174:RKPG--FFSGV:  182
         :*.*.....***


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
                   :                  +                  :            |184 aa
           11111111111111111111111111     22222222222222222222222222  |#1|2 seg
//