REPEAT (org=sent8&id=ACF65947.1)

>ACF65947.1 sent8 ACF65947.1 GIB00763CH01 "hydrogenase-1 operon protein HyaF2"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        353
#NPREPATH      1
#NNOVPATH      1
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1    64 ->   145 type S Sc  109 SqID  34.6 Zsc   6.7
#SEGMENT  2   181 ->   259 type M Sc  551 SqID 100.0 Zsc  55.7
#ALIGNMENT
1      64:MDNPVATLPFPLSYKLNATEQQNSGLLDQLLGEGEISARVLLSDGKEQ-RIQETVFTGVW:  122
2     181:VKQPVKE-PHIINLTLLPVNDADREYLDHFLGEG---CSAIFSRGYGKCRIVSTHFPGVW:  236
         :...**.. *......*..........**..****   .....*.*....**..*.*.***

1     123:RVREYNADQQRVADEIIIGPIPE:  145
2     237:RVNYFNDMNTLLQDMIEIADIPD:  259
         :**...*.......*.*.*..**.


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
         :         +         :         +         :         +         :|353 aa
            1111111111111111       222222222222222                    |#1|2 seg
//