REPEAT (org=sent8&id=ACF68527.1)

>ACF68527.1 sent8 ACF68527.1 GIB00763CH01 "tetratricopeptide repeat protein"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        722
#NPREPATH      7
#NNOVPATH      7
#NMULPATH      2
[MULTIPLE_REPEAT 1]
#NSEGMENT      3
#SEGMENT  1   214 ->   336 type S Sc  142 SqID  31.2 Zsc   8.0
#SEGMENT  2   337 ->   433 type M Sc  666 SqID 100.0 Zsc  58.4
#SEGMENT  3   434 ->   527 type S Sc  110 SqID  35.6 Zsc   5.0
#ALIGNMENT
1     214:SFYESGNLKSIYHYNAQNKRDGKAETYFDEKDKIAETLTFKDGQPEGE-YIVYHE-NGAV:  271
2     337:EYYSTGKIRGVYHRNNQGENDGTFEQY-SEEGKLLSKATYKNGKQLSA-QSWY-E-NGHP:  392
3     434:KWYENGHRESVYPYKN-GMLNGDAKHW-NEQGKLTYTTEYKDDKKQGADRRWS-ERTGKL:  490
         :  *. *   ..*......  .* .. .  * .*.  . ..*...  ..   .. * .*  

1     272:ESKRYF-AQGKIKDGECPHFYDN--GVLKQKHSYLNQKLEGPAFE:  313
2     393:KEESSFDSEGR-KHGAVKEWFSN--GKPASSKMYKHDVLDGD-FE:  433
3     491:VEEVMFANDER-N--GLKREFNDRTGKVLSALPY----VDGD-KE:  527
         : ..  *   .. . .  .  . .  *.  .   *    ..*. .*

[MULTIPLE_REPEAT 2]
#NSEGMENT      2
#SEGMENT  1   566 ->   632 type M Sc  453 SqID 100.0 Zsc  40.6
#SEGMENT  2   634 ->   704 type S Sc  110 SqID  35.8 Zsc   5.7
#ALIGNMENT
1     566:GDSTAQYHLGKY----EFECTNYDAAMKWLTQSAEQNHPGALLFLAYAYNDGDGVAQDSK:  621
2     634:GESDAQLEVGYLNLIGEGMPKNLPEAYKWIKKSADQGNAQAHYNLGLMYRNGDGVEKDLN:  693
         :*.*.**...*..    *....*...*.**...**.*....*...*...*..****..*..

1     622:KYLSYLFKAAE:  632
2     694:KAKLHLTAAVK:  704
         :*....*..*..


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
    :    +    :    +    :    +   :    +    :    *    :    +    :   +  |722 aa
                    111111111111222222222333333333                    |#1|3 seg
                                                      1111112222222   |#2|2 seg
//