REPEAT (org=sent8&id=ACF69712.1)

>ACF69712.1 sent8 ACF69712.1 GIB00763CH01 "large repetitive protein"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        3824
#NPREPATH      49
#NNOVPATH      71
#NMULPATH      3
[MULTIPLE_REPEAT 1]
#NSEGMENT      22
#SEGMENT  1   207 ->   266 type S Sc  143 SqID  46.4 Zsc   4.5
#SEGMENT  2   267 ->   368 type S Sc  179 SqID  37.2 Zsc   7.2
#SEGMENT  3   373 ->   468 type M Sc  622 SqID 100.0 Zsc  40.1
#SEGMENT  4   563 ->   660 type S Sc  232 SqID  34.7 Zsc  11.1
#SEGMENT  5   922 ->  1017 type S Sc  247 SqID  37.5 Zsc  12.2
#SEGMENT  6  1025 ->  1122 type S Sc  210 SqID  34.4 Zsc   9.5
#SEGMENT  7  1131 ->  1223 type S Sc  260 SqID  45.2 Zsc  13.2
#SEGMENT  8  1232 ->  1327 type S Sc  193 SqID  35.4 Zsc   8.2
#SEGMENT  9  1336 ->  1430 type S Sc  224 SqID  40.0 Zsc  10.5
#SEGMENT 10  1439 ->  1534 type S Sc  176 SqID  30.2 Zsc   6.9
#SEGMENT 11  1543 ->  1636 type S Sc  206 SqID  39.4 Zsc   9.2
#SEGMENT 12  1731 ->  1825 type S Sc  135 SqID  27.4 Zsc   3.9
#SEGMENT 13  1833 ->  1928 type S Sc  265 SqID  41.7 Zsc  13.6
#SEGMENT 14  1937 ->  2032 type S Sc  264 SqID  42.7 Zsc  13.5
#SEGMENT 15  2041 ->  2138 type S Sc  264 SqID  41.7 Zsc  13.5
#SEGMENT 16  2147 ->  2242 type S Sc  301 SqID  47.9 Zsc  16.2
#SEGMENT 17  2251 ->  2346 type S Sc  248 SqID  39.6 Zsc  12.3
#SEGMENT 18  2355 ->  2449 type S Sc  231 SqID  37.9 Zsc  11.0
#SEGMENT 19  2458 ->  2558 type S Sc  256 SqID  41.7 Zsc  12.9
#SEGMENT 20  2563 ->  2658 type S Sc  180 SqID  25.0 Zsc   7.2
#SEGMENT 21  2667 ->  2745 type S Sc  135 SqID  43.6 Zsc   3.9
#SEGMENT 22  2753 ->  2847 type S Sc  206 SqID  31.6 Zsc   9.2
#ALIGNMENT
1       -:---------------------------------------------SGEAEAGSTITI-K-:   -
2     267:TID--APNIPLldtpaitaaidda-apltGTLSNNQFTNDNTPTLEGTGSAGTVIHI-Y-:   -
3     373:TIDTLSPDAP-----RVELIADNT-GLLTGPLQNNDRTDEAKPLFSGQGEAGNTITI-K-:   -
4     563:S-DSQYPAQP-----TILTVTDDA-GAVTGLLKNGDATDDNRPTLSGTAEPGSTISI-N-:   -
5     922:APDITAPDKP-----IITQVLDDV-ESFTGPLVNGQTTNDNRPTLSGTAEAGARVEV-F-:   -
6    1025:VVDTQSPQQP-----VITFITDDA-PGILGSVAHLGLTNDSTPTINGTGEPGSTVHL-Y-:   -
7    1131:TIDTQAPAAP-----GVIGVADGD-G---NTIDTNQITQESQPRLSGSGTAGDTIIL-Y-:   -
8    1232:RIDTQAPDAP-----QIVSAAITG-GEGEVLLANGSITNQRMPTLSGTGEPGTIITL-Y-:   -
9    1336:TLDTQPPAQP-----DAPLISDNV-APVIGNIGNNGATNDTTPTFSGTGEIGSTIIL-Y-:   -
10   1439:TLDTTAPANP-----VITFAEDNV-GEVQDTIVSGATTDDNTPVIHGTGDIGSVITL-Y-:   -
11   1543:TVDTVPLQPP-----VVNEILDDV-APVTGPLTDGAFTNDRTLTINGSGENGSTVTI-Y-:   -
12   1731:S-DSGLPAVP-----AITAIEDDV-GSVQGNIaaggatddttptlrgttdIGSTVEV-F-:   -
13   1833:TVDLSVPAQP-----VITSATDDV-PGMTGTLDNGALTNDSRPTLNGTGEAGATIRI-L-:   -
14   1937:NIDAQAPDVP-----VITSVIDDN-NQPTVPVLPGQSTDDRQPILNGTGEPGATITI-F-:   -
15   2041:VVDITPPAIP-----VLTSVVDDQ-PGITGNLVSGQLTNDATPTLNGRGEAGATINV-YL: 2093
16   2147:TIDATPPAAP-----VIASVADNT-APVTGIVPNGGSTNETRPTLSGTGEAGTTISI-Y-:   -
17   2251:TIDTTAPAAP-----VIDTVYDGT-GPITGNLSSGQITDEARPVISGTRETNTTIRL-Y-:   -
18   2355:VVDTTPPLTP-----VITSVSDDQ-APGLGTIANGQNTNDPTPTFSGTAEAGATITL-Y-:   -
19   2458:TVDTTAPQTP-----ILTSVVDDVAGGVTGNLANGQITNDNRPTLNGTAEAGSVVSI-Y-:   -
20   2563:VVDTLAPTVP-----LITSIVDDV-PNNTGAIGNGQSTNDTQPTLNGTAEANSAVSI-F-:   -
21   2667:IVDTIAPGAP-----G-NLVINAT-G---------NRV-------TGTAEAGSTVTITS-:   -
22   2753:P-DTRVPEAP-----IITNVVDDV-GIYTGAIANGQVTNDAQPTLNGTAQAGATVSI-Y-:   -
         :  +.  +  +      .. . +.     ..   ..  +..  +.. +..+.+ .. . . 

1     220:DPSGNV-VGE---GKADSDGKFSIDLTA--PQLSGEQ-LTVTATDDAGN----TG:  263
2     322:ANG-QE-IGS---TTVDSSGSWRFAITS--ALADGENHFTAIATNVKGE----SS:  365
3     425:EGS-TV-IGS---ATVDENGRWTFTPTT--PLSDGEHTFTVEQSDKAGN----TS:  468
4     614:DNG-FP-VPTFPPIVADADGKWSFTPSL--ALADGDHVFTATATNDRGT----SG:  660
5     974:DNG-VS-LGL---ATLQPNGGWTFTPSQ--NLGEGAHRLTVIATDAKGN----AS: 1017
6    1077:QNG-AR-IAD---IIVGNSGVWSYAYTTASPLADDTYTFTVTASDSNGN----TT: 1122
7    1180:DNG-NA-IGQ---ALVGTDGRWQFTPPA--ALGDGDHLLTARANDPAGN----ES: 1223
8    1284:NNG-VE-LAT---VQVNPQGSWTYPLTR--NLSEGLNILTATATDAAGN----SS: 1327
9    1388:NNG-SE-IGR---TTVGDNGSWSFTPAA---LtpetytitvtetDIAGN----IS: 1430
10   1491:Ngs-sv-vgv---vtvdetgtWTLPVTS--ALPDGVYTLTAIAADAAGN----SS: 1534
11   1595:DNG-VA-IGT---ALVTD-GTWTFN-TP--ELSEVSHALTFSATDDAGN----TT: 1636
12   1782:IDG-DS-AGF---ATVDASGNWIFEIAT--PLSESTHYFTVQATNANGP----GG: 1825
13   1885:DNG-VE-IGS---ATVDQSGNWRFTPNA--PLENIAHIFTAVATDPAGN----SG: 1928
14   1989:DNG-TP-LGT---AQVGENGSWTFPVPR--NLSEGSHNLTVSATDPAGN----TS: 2032
15   2094:DGN-PASIGT---TTVNSDGTWSFTPQT--PLANGSHTFTLSATDPAGN----SS: 2138
16   2199:NGS-AL-VGT---AQVQANGSWSFTPST--SLGAGVWNLTATATDAAGN----TS: 2242
17   2303:DNG-TL-LAE---IPADNSSSWRYTPDA--SLATGNHVITVIAVDAAGN----AS: 2346
18   2407:ENG-TV-IGT---TTAQPDGAWSVSTST---LASGTHVITAVATDAAGN----SS: 2449
19   2511:DGD-TL-LGV---TSANASGAWSFTPTT--GLNDGTRTLTVTATDPAGNVSPATS: 2558
20   2615:DNG-AL-VAT---VNANASGNWSWTPTA--ALGQGSHAYsvsaadaagn----vs: 2658
21   2703:ETG-VV-LGT---ATADGTGSFTATLTP--AQTNGQPLLAFAQ-DKAGN----TG: 2745
22   2804:NNG-AL-LGT---TTANASGNWSFTPTG--NLTEGSHaftatatnangt----gS: 2847
         :...     .      .   + + ....    +  + .  +  +.+ .++     .

[MULTIPLE_REPEAT 2]
#NSEGMENT      6
#SEGMENT  1   472 ->   555 type S Sc  152 SqID  37.8 Zsc   5.5
#SEGMENT  2   664 ->   745 type S Sc  170 SqID  35.4 Zsc   6.9
#SEGMENT  3   749 ->   830 type M Sc  500 SqID 100.0 Zsc  32.0
#SEGMENT  4   834 ->   915 type S Sc  249 SqID  47.6 Zsc  12.9
#SEGMENT  5  1643 ->  1723 type S Sc  208 SqID  46.9 Zsc   9.8
#SEGMENT  6  2850 ->  2931 type S Sc  117 SqID  37.5 Zsc   2.8
#ALIGNMENT
1     472:ttpti--ivdttppdAAIIDNVAKDGTTVSGTAEAGSTVSIYDPAGNYLGSTITGENNHF:  529
2     664:SFTID--IDTQPPVLEGLA--VSDVGDRLTGTTEAGSTVVIKDSQGNTLGSGTAGDDGTF:  719
3     749:TLNAP--DKTAPAAPDGLI--VATDGLSVSGQAEAGATVTIRDSSNTVLGSAVANGNGQF:  804
4     834:TVIAP--DSTAPEMPKNVV--ISEDGTSISGTAEPGSAITIATPDGKPLGSGKADGEGHF:  889
5    1643:TITV---DITAPPAPTIQT--VDDDGTRVAGLADPYATVEIHHADGTLVGSAIANGTGEF: 1697
6    2850:TAATVIVDTLAPGTPSGTL--SA-DGGSLSGLAEANStvtvtltggvtl-tttAGSNGAW: 2905
         :.      . ..+  . .    .. +*....*.++..... + .  .  .++  +...+ +

1     530:SITLNPAQTHGERLEARIQDAVGNIG:  555
2     720:SIGISPAKINGETLSISVTDKAANSG:  745
3     805:IVPLNTAQTNGQALIATATDVAKNES:  830
4     890:TLPLVPAQTNGEQVTVTATDSANNVS:  915
5    1698:VVTLSPAQTDGGTLTAIAIDRAGNNG: 1723
6    2906:SLTLPTKQIEGQLINVTATDAAGNAS: 2931
         :. .+ .++..*. . ....* +.* .

[MULTIPLE_REPEAT 3]
#NSEGMENT      3
#SEGMENT  1  3034 ->  3208 type S Sc  141 SqID  30.2 Zsc   3.0
#SEGMENT  2  3288 ->  3455 type S Sc  168 SqID  32.9 Zsc   4.8
#SEGMENT  3  3524 ->  3714 type M Sc 1179 SqID 100.0 Zsc  72.5
#ALIGNMENT
1    3034:T-----TI-VNTAVGDFANLLTLTGSGVTLNLSGL--GEGQYRVLTYNTSLLATGSY---:   -
2    3288:AIQQYEQFRVQKGWINTLLL-AGQSQPLTLTLPG-----GEYLFVL---NTASGISVLTG: 3338
3    3524:AIQENGTV-IRNGTVPVANI-TLGSATVTVNLSGLELDAGTYTLNFTGTNTLAGAATITP: 3581
         :...   .  .  .    ... .. .  .*..*.*.    * *      ...... .  . 

1       -:----TSLDVDVHQTSA------GIISGPTISTGNVMaddtaptgttvtaitnangvSTPV: 3132
2    3339:YTLAISQDHTYAVDSITANTTGNVLTN----------DVVPTDALLTEVNGVAI---AAT: 3385
3    3582:RVIGTTVDLDNFETSGTHTVLGNIFDGSDAAGAMDQLNTVNTRLSISGYNGSAATLDAAA: 3641
         :    .. * .   .* .    ...  .            . .       .. .    .. 

1    3133:GAGGVDILGQYGTLHINQDGSYTYTLTKPTA--GYGHKESFTYTITQNGVGSSAAQLVIN: 3190
2    3386:GTTE--VNGLYGSLIIDARGNYTYTLKNGVGADSIKTPDSFIYTVKAPNGDTDTASLNIT: 3443
3    3642:NTTSATIQGHYGTLQINLDGAYTYTLNNGVAMSSITSKEVFTYQLDDKMGHTDSATLTID: 3701
         :...   . * **.* *. .* ***** ....  ..  ...*.*.     . .. * * * 

1    3191:LGPAPVPGSVIATDNNAS: 3208
2    3444:PTA-----RALDAI-NDV: 3455
3    3702:MAP-----QIVSTNQNDV: 3714
         :  .         .  *..


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
:+:+:+:+:*+:+:+:+:!:++:+:+:*:+:++:+:!:+:+:++:*:+:+:+:+!:+:+:+:+:*+:+:+|3824 aa
   12233 44     556678899AABB  CDDEEFFGGHHIIJJKKLMM                   |#1|22 seg
        1  22344             55                    66                 |#2|6 seg
                                                       111 222  333   |#3|3 seg
//