REPEAT (org=spne4&id=ACF55178.1)

>ACF55178.1 spne4 ACF55178.1 GIB00761CH01 "serine/threonine protein kinase"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        543
#NPREPATH      2
#NNOVPATH      3
#NMULPATH      2
[MULTIPLE_REPEAT 1]
#NSEGMENT      3
#SEGMENT  1   362 ->   397 type S Sc  141 SqID  63.9 Zsc  11.3
#SEGMENT  2   434 ->   469 type M Sc  222 SqID 100.0 Zsc  20.8
#SEGMENT  3   509 ->   543 type S Sc   80 SqID  37.1 Zsc   4.1
#ALIGNMENT
1     362:GTVLKQSLPEGTTYDLSKATQIVLTVAKKATTIQLG:  397
2     434:GTIMKQSPGAGTTYDVSKPTQIVLTVAKKVTSVAMP:  469
3     509:GMVVEQSPRAGEKVDLNK-TRVKISIYKPKTTSATP:  543
         :*.. .**. .*...*..* *.......*. *. . .

[MULTIPLE_REPEAT 2]
#NSEGMENT      2
#SEGMENT  1   326 ->   361 type M Sc  156 SqID 100.0 Zsc  13.0
#SEGMENT  2   398 ->   433 type S Sc  120 SqID  75.0 Zsc   8.8
#ALIGNMENT
1     326:NYVGRKSSDVIAELKEKKVPDNLIKIeeeesneseA:  361
2     398:NYIGRNSTEVISELKQKKVPENLIKIeeeesseseP:  433
         :**.**.*..**.***.****.**********.***.


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
      :     +      :     +      :     +      :     +      :     *     |543 aa
                                              1111     22222     33333|#1|3 seg
                                         11111    22222               |#2|2 seg
//