REPEAT (org=tfus0&id=AAZ54369.1)

>AAZ54369.1 tfus0 AAZ54369.1 GIB00263CH01 "hypothetical protein"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        307
#NPREPATH      2
#NNOVPATH      2
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      3
#SEGMENT  1   167 ->   202 type S Sc   59 SqID  48.6 Zsc   2.3
#SEGMENT  2   203 ->   242 type M Sc  243 SqID 100.0 Zsc  25.5
#SEGMENT  3   258 ->   305 type S Sc   57 SqID  43.6 Zsc   2.1
#ALIGNMENT
1     167:RLADV-TGE----ITAESATGR--ITAAGSG-PSAVV---TSDTGEI---:   -
2     203:NLEDFQAAD----VQATSAIGA--IRI-GSGFDTARV---RSDTGAITVT:  242
3     258:NIE-LQVPDRVYRVTADTTVGSPKVAV-DQSRDATSVIEARSDTGDITIT:  305
         :.... .  .    ..* .. *   .   ... . . *   .**** *. .


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
           :          +           :          +           :          + |307 aa
                                     11111111222222222    33333333333 |#1|3 seg
//