REPEAT (org=tfus0&id=AAZ54441.1)

>AAZ54441.1 tfus0 AAZ54441.1 GIB00263CH01 "hypothetical protein"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        1523
#NPREPATH      2
#NNOVPATH      1
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      2
#SEGMENT  1  1096 ->  1174 type M Sc  503 SqID 100.0 Zsc  38.7
#SEGMENT  2  1178 ->  1258 type S Sc  118 SqID  34.2 Zsc   4.6
#ALIGNMENT
1    1096:YVTDLR--GEHSDSKQLAEATLSVWREKLGKTAPETLRAELYLVRALRNLGERKRAYELC: 1153
2    1178:FVRDLRYAGRFHDSVELARDTRDRYRRILGPDDPETISASHVYAYALLLAGDHRRAADLF: 1237
         :.*.***  *...**..**..*....*..**...***..*......**...*...**..*.

1    1154:ERVLRILTEQHGPDSEEALEA: 1174
2    1238:WEIYQTNEMILGPNNPSTLAA: 1258
         :...........**.....*.*


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
  : + :  + : +  : + : *  : + :  + : +  : + : !  : + :  + : +  : + : * |1523 aa
                                                 11112222             |#1|2 seg
//