REPEAT (org=tthe0&id=AAS82166.1)

>AAS82166.1 tthe0 AAS82166.1 GIB00176CH01 "SSU ribosomal protein S1P"
#RepAlignM (coded by Takeshi Kawabata) LastModDate:January 19, 2002
#LENGTH        536
#NPREPATH      4
#NNOVPATH      5
#NMULPATH      1
[MULTIPLE_REPEAT 1]
#NSEGMENT      5
#SEGMENT  1     9 ->    94 type S Sc  135 SqID  33.3 Zsc   8.3
#SEGMENT  2    95 ->   160 type S Sc   97 SqID  42.6 Zsc   4.4
#SEGMENT  3   178 ->   266 type S Sc   82 SqID  23.5 Zsc   2.9
#SEGMENT  4   267 ->   353 type S Sc  336 SqID  54.7 Zsc  28.9
#SEGMENT  5   354 ->   440 type M Sc  583 SqID 100.0 Zsc  54.2
#ALIGNMENT
1       9:PEQ---TFS----MEAALQ-ETE---ARLEKRVRPGQI-LTGKVVLVGSEGVAVDIGAKT:   56
2       -:-ETGQILLS----RKKIEAQEKWDRIQELYEKGEPVTVTIKERVKG----GVVAELD-GI:  144
3     178:RRKGRVILSRRAVLEEEQK-KAR---EAFLKSLEPGQv-vegtvvevtdfgvfvNLGP-V:  231
4     267:PEKERVNLS----IKALIP-DPW---TTVAEKYPVGTR-VRGKVVGLTQFGAFVEVEPGL:  317
5     354:PEERRLSLG----LKQTQP-DPW---QQLTEKYPPGTV-LKGKVTGVTDFGVFVEIEPGI:  404
         :.+  .  ++     .       .     . ..  ++.    ..+ .    +. ..  .. 

1      57:EGIIPFNQLT-TKPLSEEELRNLLSPGDEVKVQVLRVDP:   94
2     145:QGFMPASQLD-LRRV--PN--------------------:   -
3     232:DGLVHRSEIT-WGRF--NHPREVIQKGQKVKAQVLSVD-:   -
4     318:EGLIHISELSWTKRP--KHPSEVVKEGDEVEAVVLRLD-:   -
5     405:EGLVHVSELD-HKRV--ENPAALFKKGDEMEVVVLNIDP:  440
         :.*. . +.+   .+     .      +...   ++  + 


[MULTIPLE_REPEATS_SYMBOLIC_OUTPUT]
      :      +     :      +     :      +     :      +     :      *    |536 aa
11111111111222222222  33333333333344444444444555555555555             |#1|5 seg
//