[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK85915.1"

            "conserved hypothetical protein"
Y095_AGRT5  "RecName: Full=UPF0133 protein Atu0095;"

OrgPattern -------------------------------------------------------------------- -11--111---111----------------------11----11---------------------1-------------------1----------1---------111---------11----1--1-1-11--111111---111-11--11111-------111111-------------1-1--11-1-1111111111111111-1--111111--1--1--------------------------------------------------------------------------------------------------111------------1111-----1--1--1----1-----111111---11----1111111111111111111111111-1111-11-1111111111111111111111111111111111111111111111111111------------111111111111-11111111-1111111111111111111111111111111-1-111111111111111111111111111111111111111-111-111-11111------11211-11-11-------------------------111111-11111111111111111111111111-11111--111111111111111111111-1111111111111111111111111111111111111111111-1111111-1111111111111--1-1111111111-1-1111111111111111111111-11-11111111-1111111111111111-111111-111111111111111111111111-1--111111------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRDIMGMMGKVKEMQSKMEKVQQEIAALEIEGRAGGGLVTVILNGKGEMRGLKIDPSLFK:Sequence : cHHHHHHHHcccccHHHHHHHHcEEEEEEGGGTEEEEEETTccEEEEEEcGGGHH:Sec Str :#### :PROS|1->4|PS00228|TUBULIN_B_AUTOREG|PDOC00200| : ========================:RP:SCP|37->96|1j8bA|1e-21|50.8|59/92|d.222.1.1 :============================================================:BL:SWS|1->107|Y095_AGRT5|7e-57|100.0|107/107 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->97|PF02575|1e-16|53.4|88/93|DUF149 61: . . . * . .: 120 :EDEVEILEDLIVAAHKDAKEKGEAQAQEKMADLTAGLPLPPGMKLPF :Sequence :GccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccTccccc :Sec Str :==================================== :RP:SCP|37->96|1j8bA|1e-21|50.8|59/92|d.222.1.1 :=============================================== :BL:SWS|1->107|Y095_AGRT5|7e-57|100.0|107/107 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|10->97|PF02575|1e-16|53.4|88/93|DUF149