[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK86297.2"

            "two component response regulator"
            ""

OrgPattern -------------------------------------------------------------------- 9BB3O4442223--32322-24--3522222265558CAC456J9A641443553231--35D4KBDIMH42111223-33-8-----------11---1-212153C11-------------------1------8888B336D5512422211------11-3-86471------------57511--2355444444542544445758847464142421222222267333333333333333333421---22-1---1111221---1-11112222123221222222222211111111111113122222221151421111211-1-11------1-1--A111-42112124-11111---4-13--1-----13G454336446655455544445-77488765476-65548688B789431-14126556335--------111--663-------------------------------331-3422353332414442229944441423587AF-16646643233668-35-3414211111111--1737213---12-12----2-311312211313342------------------------1--43-422645214434514444435335346---2313------73333636775655566-6666656666656556553424453226455666566546456666555651-644444344444--1212111-----292111111111111-11211111111-11288984A89777863866---------12343122222323498667654451111--1-111111--------2-------------------------------------1E- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--2-----2---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSELVIIIADDHPLFRGALKQAVAGLDGQQTIIEAGDFEAARHAATTRNDADLMLLDLAM:Sequence :cccccEEEEcccHHHHHHHHHHHHTcTTEEEEEEEccHHHHHHHHHHHHcccEEEEccEE:Sec Str : XXXXXXXXXXX:SEG|50->60|dadlmlldlam : =======================================================:RP:SCP|6->123|1ny5A1|3e-11|16.5|115/137|c.23.1.1 : =======================================================:BL:SWS|6->213|AGMR_PSEAE|7e-34|47.5|200/221 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->119|PF00072|8e-07|28.8|111/111|Response_reg 61: . . . * . .: 120 :PGVSGFSGLMALRAEFSSLPIVIVSATDDATTVRRSIELGASGFISKSSGIDDIRDGIRA:Sequence :TTEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|6->123|1ny5A1|3e-11|16.5|115/137|c.23.1.1 :============================================================:BL:SWS|6->213|AGMR_PSEAE|7e-34|47.5|200/221 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->119|PF00072|8e-07|28.8|111/111|Response_reg 121: . . + . . .: 180 :VLEGDVWIPSGHQGEKEQDPDVADLIGRLRTLTPQQSRVLGMLAEGLLNKQIAYELNVSE:Sequence :HHHHGGGccHHHHHHHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHHHHHHTccH:Sec Str : ###############:PROS|166->193|PS00622|HTH_LUXR_1|PDOC00542| :=== :RP:SCP|6->123|1ny5A1|3e-11|16.5|115/137|c.23.1.1 : =================================:RP:SCP|148->204|1a04A1|2e-13|40.4|57/67|a.4.6.2 :============================================================:BL:SWS|6->213|AGMR_PSEAE|7e-34|47.5|200/221 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|151->203|PF00196|7e-11|54.7|53/57|GerE 181: . * . . . .: 240 :ATIKAHVSAILLKLKVDSRTQAVIQLAKINTSAMVA :Sequence :HHHHHHHHHHHHHTTcccccHHHEEHHTHTcc :Sec Str :############# :PROS|166->193|PS00622|HTH_LUXR_1|PDOC00542| :======================== :RP:SCP|148->204|1a04A1|2e-13|40.4|57/67|a.4.6.2 :================================= :BL:SWS|6->213|AGMR_PSEAE|7e-34|47.5|200/221 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|151->203|PF00196|7e-11|54.7|53/57|GerE