[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK86489.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-1-111111111123------------------------------------------------------------------------------------1---------1---11--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------1---1-1------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQLIGDTPITYRRYSMSSSQNALVLIARILLSFIFIYSGFGKLTDPAGTAGMIAGAGMPA:Sequence : XXXXXXXXXXXXXXX:SEG|46->69|pagtagmiagagmpaatalaylag 61: . . . * . .: 120 :ATALAYLAGLFELVAGLAILAGFQTKIAAWALAVFCVFTGLVFHSGTVAVPGWPEPALGW:Sequence :XXXXXXXXX :SEG|46->69|pagtagmiagagmpaatalaylag : ===================================================:BL:SWS|70->155|YPHA_SHIFL|9e-05|37.2|78/140 121: . . + . . .: 180 :INTLNGIMMMKNITLAGAYILLATFGAGAYSVDAKRGFVAARA :Sequence :=================================== :BL:SWS|70->155|YPHA_SHIFL|9e-05|37.2|78/140 : ============================== :BL:SWS|124->153|YQJF_ECOLI|6e-06|53.3|30/130