[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK86691.1 atum0 AAK86691.1 "hypothetical protein"
MQDAAEWSEELDALRFAVPGHGAPCAVHRLAFKAVLGATPEREAALACFHEHEAAFIAAA
LSKIKRANLPAGRSLHLNSRDIRRAISGEGEEPAARVCRLLDRG
//