[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK86734.2"

            "amide hydrolase"
            ""

OrgPattern ---------------------------------------------------1---------------- --1-2----------1111-1---1-11111--1111-1----11-----1-1---------------1------------------------2------1--1-122-1----------------------------------1-11-----------1----------1-----------------------222222211122332------212-------------11-----------------------------------------------------------------------------------------------------------------------1---11-----1---------1---111-------364---1-11111121111-11--------1-21--22--1---1--1-331-------113------------1---------------------------------2511-------223312----11--------21-2221--211-----2---6-21---------------1---1--------------------------1-1----------------------------------1-1-1--------11----1--2-4-------1-------------------------------------------111------------------------------------------------------------1-----------------------2-1-3132-112----1-11----------1---1------1---------1-----------11---------------------------------------------------1- ----------------1-------1-------------------------1121--------------------------------------1-------------------------------------------------------------------------------------------1---1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLAAVLPVLVFPHGASSQVATPLSAEQSDPLKLGWMQGFPPPEDKIIRFSDSDYFNFPKS:Sequence : ccccTTccTTcccTTT TTcTTHH:Sec Str : =========================:RP:SCP|36->428|1wybA1|2e-35|29.2|366/378|e.3.1.1 : ===:BL:SWS|58->406|NYLB_FLASK|3e-53|35.8|335/392 61: . . . * . .: 120 :RWTVCHFRQLMPTVNVSRGLGAPAALERKLDPAMDAVTFRPTGADQDMTWLQSLSANYTD:Sequence :HHHTTcGGGTcccccccccccccEEEcTTcTTTcTTHHHHHHHHTcHHHHHHHHHHTTEE:Sec Str :============================================================:RP:SCP|36->428|1wybA1|2e-35|29.2|366/378|e.3.1.1 :============================================================:BL:SWS|58->406|NYLB_FLASK|3e-53|35.8|335/392 121: . . + . . .: 180 :GIVVLHKGVLVYERYSGCLNEAGQHGAMSVTKSLTGLLGEMLVAEGTLDENAKVATVVPE:Sequence :EEEEEETTEEEEEEEcTTccTTccEEcTTHHHHHHHHHHHHHHHTTcccTTccGGGTcGG:Sec Str :============================================================:RP:SCP|36->428|1wybA1|2e-35|29.2|366/378|e.3.1.1 :============================================================:BL:SWS|58->406|NYLB_FLASK|3e-53|35.8|335/392 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|122->393|PF00144|1e-13|33.3|249/324|Beta-lactamase 181: . * . . . .: 240 :LEKSAFGDATIRQVLDMTTGLRYSEDYADPNADVWIYSAAGNPLPKPDGYEGPRSYFDYL:Sequence :GTTcTTccccHHHHHTTccccccccTcccTTcTTcHHHHHHHHHTcccccTTccccHHHH:Sec Str :============================================================:RP:SCP|36->428|1wybA1|2e-35|29.2|366/378|e.3.1.1 :============================================================:BL:SWS|58->406|NYLB_FLASK|3e-53|35.8|335/392 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|122->393|PF00144|1e-13|33.3|249/324|Beta-lactamase 241: + . . . . *: 300 :KTVVKQGENGSAFGYKTINSDALGWVIARASGKSVAELLSQRIWSRIGAEQDAYYTVDST:Sequence :HHTcccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHTGGGTTcccccEEcccTT:Sec Str :============================================================:RP:SCP|36->428|1wybA1|2e-35|29.2|366/378|e.3.1.1 :============================================================:BL:SWS|58->406|NYLB_FLASK|3e-53|35.8|335/392 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|122->393|PF00144|1e-13|33.3|249/324|Beta-lactamase 301: . . . . + .: 360 :GTPFAGGGLNAGLRDMARIGQLLLDDGMAGGHRLIPQKAIDNIRHGGDKAAFAKGGYPAL:Sequence :ccccTTTcEEEcHHHHHHHHHHHHTTTEETTEEcccHHHHHHHHHcccGGGccHHHHTTc:Sec Str :============================================================:RP:SCP|36->428|1wybA1|2e-35|29.2|366/378|e.3.1.1 :============================================================:BL:SWS|58->406|NYLB_FLASK|3e-53|35.8|335/392 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|122->393|PF00144|1e-13|33.3|249/324|Beta-lactamase 361: . . . * . .: 420 :RGWSYRAMWWVTHNANGAFMARGVHGQAIYVDPAADMVIARFSSHPVASNAANDPTSLPA:Sequence :TTcEEETTEEEcccTTccEEEEETTTEEEEEEGGGTEEEEEEEcccccccHHHHHHHHHH:Sec Str :============================================================:RP:SCP|36->428|1wybA1|2e-35|29.2|366/378|e.3.1.1 :============================================== :BL:SWS|58->406|NYLB_FLASK|3e-53|35.8|335/392 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|122->393|PF00144|1e-13|33.3|249/324|Beta-lactamase 421: . . + . . .: 480 :YEAVARYLMGGAARP :Sequence :HHHHHHHTHHH :Sec Str :======== :RP:SCP|36->428|1wybA1|2e-35|29.2|366/378|e.3.1.1