[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK86736.1"

            "penicillin binding protein"
            ""

OrgPattern -------------------------------------------------------------------- 333-322222222232222-23222422222234443344233322212222232111115523324645421222221131411111445214111--23443236515---------------2222212222222233---216333333233312122243224673111-11111-11232111124346666676666666665444446674434433222222443333333333333333333332223422323222233322222333333333333333333333333333333333333343333333331322111111211211211111131411322312333222522111212145-766422222555555545555533333333335-778789776541555566566667453444344344344111111111111333511----------22221222111121---1324524444478878756665774566663686467771222233344464442333222332222222222222453532133222222133333343355455434122131121121211111111111122443233322233444333233332422322--11213-1-11144333434444444444-4444444444444344444444334444444444444444443443332343143444544444411131111122223542433333313332322423333333333433334335444443444---------122232222233222444444433333331-136666661111111121--------------------------1-11111111--3 -------------1-----------------------------------------------------------------------------------------------------------------------------------------------------1--------------11-----1--3--1--1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVLRREWVETQKYRRAALPRTGKHRQVQEEKDDNKGRRKRHILLRIDSFIDSGLWTAAAR:Sequence : :Sec Str 61: . . . * . .: 120 :LVDFWEDVTIASRKLHVRGWKKLVVNLTCDALTFGTAGSIVLLALAMPAFEETKKDWRYR:Sequence : :Sec Str 121: . . + . . .: 180 :GDFAVTFLDRYGNTIGHRGIIHEDSVPIDQMPDHFIKAVLATEDRRFFDHFGIDFIGLAR:Sequence : cEEEEcTTccEEEEEcccccccccGGGccHHHHHHHHHHHccccTTcccccHHHHHH:Sec Str : =======================================================:RP:SCP|126->324|2oluA1|2e-47|33.5|182/208|d.2.1.10 : =====================================================:BL:SWS|128->666|PBPF_BACSU|1e-67|31.5|533/714 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->307|PF00912|2e-42|51.2|162/178|Transgly 181: . * . . . .: 240 :AMSENARAGGVVQGGSTLTQQLAKNLFLTNERSLERKIKEAFLALWLESNMSKKEILSLY:Sequence :TTTTcTTccccccccccHHHHHHHHTcccccccHHHHHHHHHHHHHHHHHccHHHHHHHH:Sec Str :============================================================:RP:SCP|126->324|2oluA1|2e-47|33.5|182/208|d.2.1.10 :============================================================:BL:SWS|128->666|PBPF_BACSU|1e-67|31.5|533/714 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->307|PF00912|2e-42|51.2|162/178|Transgly 241: + . . . . *: 300 :LDRAYMGGGTFGAAAAAQFYFGKNLTDVTLSESAILAGLFKAPAKYAPHVNLPAARARAN:Sequence :HHHccccTTcccHHHHHHHHTccccTTccHHHHHHHHHTTccHHHHcTTTcHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXX :SEG|247->262|gggtfgaaaaaqfyfg :============================================================:RP:SCP|126->324|2oluA1|2e-47|33.5|182/208|d.2.1.10 :============================================================:BL:SWS|128->666|PBPF_BACSU|1e-67|31.5|533/714 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->307|PF00912|2e-42|51.2|162/178|Transgly 301: . . . . + .: 360 :TVLSNLVQSGLMTEGQVIGARRNPATVIDRADVKAPDYFLDWAFDEVQRLAAEGKFKDHT:Sequence :HHHHHHHHTTcccHHHHHHHTTcccGGGcccccccccGGGHHHHHHHHHHTTcGGGcccc:Sec Str :======================== :RP:SCP|126->324|2oluA1|2e-47|33.5|182/208|d.2.1.10 : ===================================================:RP:SCP|310->676|2bg1A1|4e-55|19.2|360/452|e.3.1.1 :============================================================:BL:SWS|128->666|PBPF_BACSU|1e-67|31.5|533/714 :$$$$$$$ :RP:PFM|146->307|PF00912|2e-42|51.2|162/178|Transgly 361: . . . * . .: 420 :VVVRTTIDTGLQQAAEQAMEMELREYGEGYRVKQGAMVMIENGGGVRAMVGGRDYGESQF:Sequence :HEEEEcccHHHHHHHHHHHHHccccccTTEccEEEEEEEEETTccEEEEEccTTccTTTc:Sec Str :============================================================:RP:SCP|310->676|2bg1A1|4e-55|19.2|360/452|e.3.1.1 :============================================================:BL:SWS|128->666|PBPF_BACSU|1e-67|31.5|533/714 : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|396->640|PF00905|1e-38|45.0|240/289|Transpeptidase 421: . . + . . .: 480 :NRATAALRQPGSSFKVYTYSAAMEKGMKPDTLISDAPVTWRGWSPQNYGRSYAGKVTLQV:Sequence :ccTTTccEEcGGGGHHHHHHHHHHHcccTTcEEEcccccccccccccTTcccccEEEHHH:Sec Str :============================================================:RP:SCP|310->676|2bg1A1|4e-55|19.2|360/452|e.3.1.1 :============================================================:BL:SWS|128->666|PBPF_BACSU|1e-67|31.5|533/714 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|396->640|PF00905|1e-38|45.0|240/289|Transpeptidase 481: . * . . . .: 540 :ALAKSYNTVPVRLAKDVLGTQVIVDTAKAMGVATPLRSDKTIPLGTSEVTVLDQATAYAV:Sequence :HHHTTcHHHHHHHHHHHHHHHccTTHHHHHHHHTTcccccHTTcTTcEEcHHHHHHHHHH:Sec Str :============================================================:RP:SCP|310->676|2bg1A1|4e-55|19.2|360/452|e.3.1.1 :============================================================:BL:SWS|128->666|PBPF_BACSU|1e-67|31.5|533/714 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|396->640|PF00905|1e-38|45.0|240/289|Transpeptidase 541: + . . . . *: 600 :FPADGMQSRRHGIEQVMDYEGNVLYDFSHDEPPAKRVLSEEANSKMNQMLVTIPVMGTAR:Sequence :HTTTcEEEccccEEEEEcccccEEEccHHHcccEEEcccHHHHHHHHHHHHTTccTTcTT:Sec Str :============================================================:RP:SCP|310->676|2bg1A1|4e-55|19.2|360/452|e.3.1.1 :============================================================:BL:SWS|128->666|PBPF_BACSU|1e-67|31.5|533/714 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|396->640|PF00905|1e-38|45.0|240/289|Transpeptidase 601: . . . . + .: 660 :RGALDNGIVSGGKTGTSQAYRDAWYVGFTGNYTTAVWFGNDEFTPMNNMTGGALPAMTYK:Sequence :TTccccccccEEEEEEEEEEEEEEEEEEcccEEEEEEEEEccccGGGHHHHHTHHHHHHH:Sec Str :============================================================:RP:SCP|310->676|2bg1A1|4e-55|19.2|360/452|e.3.1.1 :============================================================:BL:SWS|128->666|PBPF_BACSU|1e-67|31.5|533/714 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|396->640|PF00905|1e-38|45.0|240/289|Transpeptidase 661: . . . * . .: 720 :RLMDYAHQGMELRPIPGIQNLLPTGARPQPSAQVAAASATTAPAMPALTRPRSLSAEATR:Sequence :HHHHHHccccccccccHHHHHHH :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|686->712|arpqpsaqvaaasattapampaltrpr :================ :RP:SCP|310->676|2bg1A1|4e-55|19.2|360/452|e.3.1.1 :====== :BL:SWS|128->666|PBPF_BACSU|1e-67|31.5|533/714 721: . . + . . .: 780 :VIRSIAKTMKEAPPLAVTTQKVAEATIRDGRDEAGRR :Sequence : :Sec Str