[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK86736.1 atum0 AAK86736.1 "penicillin binding protein"
MVLRREWVETQKYRRAALPRTGKHRQVQEEKDDNKGRRKRHILLRIDSFIDSGLWTAAAR
LVDFWEDVTIASRKLHVRGWKKLVVNLTCDALTFGTAGSIVLLALAMPAFEETKKDWRYR
GDFAVTFLDRYGNTIGHRGIIHEDSVPIDQMPDHFIKAVLATEDRRFFDHFGIDFIGLAR
AMSENARAGGVVQGGSTLTQQLAKNLFLTNERSLERKIKEAFLALWLESNMSKKEILSLY
LDRAYMGGGTFGAAAAAQFYFGKNLTDVTLSESAILAGLFKAPAKYAPHVNLPAARARAN
TVLSNLVQSGLMTEGQVIGARRNPATVIDRADVKAPDYFLDWAFDEVQRLAAEGKFKDHT
VVVRTTIDTGLQQAAEQAMEMELREYGEGYRVKQGAMVMIENGGGVRAMVGGRDYGESQF
NRATAALRQPGSSFKVYTYSAAMEKGMKPDTLISDAPVTWRGWSPQNYGRSYAGKVTLQV
ALAKSYNTVPVRLAKDVLGTQVIVDTAKAMGVATPLRSDKTIPLGTSEVTVLDQATAYAV
FPADGMQSRRHGIEQVMDYEGNVLYDFSHDEPPAKRVLSEEANSKMNQMLVTIPVMGTAR
RGALDNGIVSGGKTGTSQAYRDAWYVGFTGNYTTAVWFGNDEFTPMNNMTGGALPAMTYK
RLMDYAHQGMELRPIPGIQNLLPTGARPQPSAQVAAASATTAPAMPALTRPRSLSAEATR
VIRSIAKTMKEAPPLAVTTQKVAEATIRDGRDEAGRR
//