[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK86987.1"

            "DNA-directed RNA polymerase"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------11---------1--------------------------------------------------------------------------------------1----------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------11--1-----------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------- 11--111-311-11211111111111111111111111111111111211111111111111122111-21121211-1112222211-13111112111111111-111111121-111-1111111-2B1-112-1-11111--11-----2111111111112211232231111181111132371411121111 ------1-----------------------------------------1-1----------11-111-1---------------------------------------------------------------------------------------------------1------

Master   AminoSeq   


1: . . . . + .: 60 :MIELDTTNELFLAAHGCLPTEHEAWEKQIALEEEMRSAGIARFEKGLEKNREKNAEASNL:Sequence : cHHHHccHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHTccTHHHH:Sec Str : ====================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 : ==================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 61: . . . * . .: 120 :SSRRMIIHAHAQVIAGLEAFLAEASSGKAGKKHTAVAYLKDADLDVVAHLTLRNLFDYVS:Sequence :HHccHcTTHHHHHHHHHHHHHHHHHHHccccccHHHHHTTcccHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 121: . . + . . .: 180 :MRMKLTPLSIRLAAMVEDELFFNAFKGHDKDAYEYARKKISEQTHNAVHQKRAMTKHAKH:Sequence :ccccHHHHHHHHHHHHHHHTTcccHHHHHHHHHTccccccccHHHcccccccTTccTTTT:Sec Str :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 181: . * . . . .: 240 :KGAEWQDWSQDVKAKVGLKLIEIAVEQTGLFEIVRQSEGAHNTNIYVVATKETLDWLATE:Sequence :ccccccccccHHHHHHHHHHHHHHcTTcccEEEEEEcTTcHHTTccTTTcEEEEEEcHHH:Sec Str :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 241: + . . . . *: 300 :NSRLAPLSPVYLPTLVPPRPWTSPFRGGYWSGRVRNLRLIKTGNRQYLMDLESVDMPKVY:Sequence :HcccccccHHHHHHHHHHHHHHHHHHcccEEEEccccEEEEEcHHHHHHHHHTccccGGG:Sec Str :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 301: . . . . + .: 360 :HSINAMQNTAWSINHRVYEVMASLWDNQSTLACIPQADDMPLPEKPMWLAPEMKREDMSP:Sequence :GccccccccccccccccccccccccccccccccccccccHHHHHTcTTcccHHHHHHHHH:Sec Str :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 361: . . . * . .: 420 :EQLEEFSRWKSERTTIYEANARAVSKRLAFSRMLGVATRFKDEEEFYFPHQMDFRGRVYA:Sequence :EEEcHHHHHHHHHHTcHccTTcHHHHHHHHHHHHHHHHHTcccccccccEEEcccccEEE:Sec Str :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 421: . . + . . .: 480 :VPLFLNPQGDDASHGLLQFANSVPITNEEGADWLAIHGAGLWGVDKCSMNERVEWVMANQ:Sequence :ccccccccccHHHHHHEEEcccEEccHHHHHHHHHHHHHHHHTcccccHHHHHHHHHTTH:Sec Str :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|448->862|PF00940|7e-79|44.2|380/394|RNA_pol 481: . * . . . .: 540 :REILASAENPYDNRFWLTAEKPWQALAFCFEWQGYVAEGFAFHSHLPVQMDGTCNGLQNF:Sequence :HHHHHTTcTTTTccTGGGccccHHHHHHHHHHHHHHHHcTTcEEccccccccccccHHHH:Sec Str : ############ :PROS|527->538|PS00900|RNA_POL_PHAGE_1|PDOC00410| :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|448->862|PF00940|7e-79|44.2|380/394|RNA_pol 541: + . . . . *: 600 :SAMLLDEIGGAAVNLVPSDKPNDIYATVASVLIAKLRDIAAACPEDTTTKEVKDKETKEN:Sequence :HHHHTcHHHHTTcccccccccccHHHHHHHHHHHHHHHHHTcccccccccccHcccccEE:Sec Str : XXXXXXXXXXXXXXXX:SEG|585->602|edtttkevkdketkenkt :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|448->862|PF00940|7e-79|44.2|380/394|RNA_pol 601: . . . . + .: 660 :KTIVVESDGSMARKWLAYGITRKVTKRPVMTLAYGASEFGFREQVFTDTVTPWKQAAGEA:Sequence :cccccccccccTTHHHHHcccTTTccTTTTccccccTTHHHHHHHHHHTTHH HHTTTcc:Sec Str :XX :SEG|585->602|edtttkevkdketkenkt : ############### :PROS|620->634|PS00489|RNA_POL_PHAGE_2|PDOC00410| :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|448->862|PF00940|7e-79|44.2|380/394|RNA_pol 661: . . . * . .: 720 :FPFEGTGFAAASFLGLLIWDCVGEVVVAAAGAMDWLQKVAKIAAKESLPVIWNTPAGLKV:Sequence :TTcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHTcccccEEEEcTTccEE:Sec Str : XXXXXXXXXXX :SEG|682->692|vgevvvaaaga :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|448->862|PF00940|7e-79|44.2|380/394|RNA_pol 721: . . + . . .: 780 :MQEYTTSEQKRLELTFQKVRLQLSIDVASKKIDKRKQGSGISPNWVHSMDAAHMQLTVSR:Sequence :EEccEEccccccccccccccccccccccccEEcHHHHHHTHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|448->862|PF00940|7e-79|44.2|380/394|RNA_pol 781: . * . . . .: 840 :CHDEGIRSFSLIHDSYGTHAGNAWAMAQFLREEFVKMYGDHDVLAEFGREITAMLPEGTQ:Sequence :TTTTTccccEEccccEEccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHTTccTTTT:Sec Str :============================================================:RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :============================================================:BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|448->862|PF00940|7e-79|44.2|380/394|RNA_pol 841: + . . . . *: 900 :LPPLPEKGSLDLSQVLESAFFFA :Sequence :ccccccccccccGGGcccccccc :Sec Str :================== :RP:SCP|25->858|1aroP|0.0|39.1|729/774|e.8.1.3 :======================= :BL:SWS|27->863|RPOL_BPT7|e-137|40.0|814/883 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|448->862|PF00940|7e-79|44.2|380/394|RNA_pol