[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK87068.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRLPLAIPAFLAAMSTPVLAQTATDEGGVSLSGGGSSTIKQLLSSGYEIKASVPNGSKFI:Sequence : XXXXXXXXXXX :SEG|27->37|ggvslsgggss 61: . . . * . .: 120 :VFMQKDKAAYACEFVTVARSRCETLN :Sequence