[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK87226.2"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11122-112--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MESVGWIAAIIIGGLAGWLAGKLMDMRFGIFMNIILGIVGSVVAVAVLRTLDVFVQDSRL:Sequence : XXXXXXXXXXXXXXXXX :SEG|5->21|gwiaaiiigglagwlag 61: . . . * . .: 120 :GYFVTSFLGASLLLFVAKLVRR :Sequence