[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK87226.2 atum0 AAK87226.2 "conserved hypothetical protein"
MESVGWIAAIIIGGLAGWLAGKLMDMRFGIFMNIILGIVGSVVAVAVLRTLDVFVQDSRL
GYFVTSFLGASLLLFVAKLVRR
//