[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK87429.2"

            "nitroreductase"
            ""

OrgPattern ------1111111111---------------------------1----1-----------------11 ---11-------2-11111-11--1111111111111111-111----------------11111-11111----------11------------------11--1-------------------111111-1111---------1------------------------1------------11-11---------------------------------2---------2--------------------------------------------------------------------------------------------------------------------------1-111--1-1-111--1--------------11111---1111111111111111-21111111-1--11111111111111---1-1111111111111111-11-1111-------------------------------1--------111111111111111111111111---1----1-211111111-11111111-----------111---------------12111-3-------1-----------------------------------1-----------1------11--1-------------------------------------------------------------------------------------------------------------1-1-1-------------------------1-11111111111111111---------------------1------------------1-------------------------------------------------------- -1----------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQANPFDHALSPARPFSGAEREAIYRAIETRRDVRDQFLPDPLPEELVERLLKAAHSAPS:Sequence : cccccccccccccHccHHHHHHHHHTccccccccccccccHHHHHHHHHHHHTccc:Sec Str : ======================================:RP:SCP|23->226|1bkjA|5e-32|25.4|177/230|d.90.1.1 : =============================================:BL:SWS|16->217|BLUB_RHOCA|2e-27|36.2|199/207 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->194|PF00881|1e-12|34.0|153/157|Nitroreductase 61: . . . * . .: 120 :VGFMQPWNFTLVTDGGVRQAAWVAFSRANEEAAAMFEGEKQALYRSLKLEGIRKAPLSIC:Sequence :GGGcccEEEEEcccHHHHHHHHHTTTcTHHHHHHHTTccTHETTGGGGHHHHHHccEEEE:Sec Str :============================================================:RP:SCP|23->226|1bkjA|5e-32|25.4|177/230|d.90.1.1 :============================================================:BL:SWS|16->217|BLUB_RHOCA|2e-27|36.2|199/207 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->194|PF00881|1e-12|34.0|153/157|Nitroreductase 121: . . + . . .: 180 :VTCDPTRGGKVVLGRTHNPRTDVYSTVCAIQNLWLAARAEGIGVGWVSIFHDSDVRAILD:Sequence :EEEEcHHcTTcccccHHHHHHHHHHHHHHHHHHHHHHHHTTcEEEEEGGGGHHHHHHHTT:Sec Str :============================================================:RP:SCP|23->226|1bkjA|5e-32|25.4|177/230|d.90.1.1 :============================================================:BL:SWS|16->217|BLUB_RHOCA|2e-27|36.2|199/207 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->194|PF00881|1e-12|34.0|153/157|Nitroreductase 181: . * . . . .: 240 :IPEHIEIVAWLCLGRVDALYTEPELAVKGWRQRVPLEELVFRNRWGGR :Sequence :ccTTEEEEEEEEEEccccccGGGcGGcccccccccHHHHccccccccc :Sec Str :============================================== :RP:SCP|23->226|1bkjA|5e-32|25.4|177/230|d.90.1.1 :===================================== :BL:SWS|16->217|BLUB_RHOCA|2e-27|36.2|199/207 :$$$$$$$$$$$$$$ :RP:PFM|28->194|PF00881|1e-12|34.0|153/157|Nitroreductase