[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK87903.2"

            "conserved hypothetical protein"
            ""

OrgPattern ---------------------------1-11------------------------------------- ---------------------------------------------11-1-----1-----111-------1-111111-----------------------1-----2------------------------------------1---------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------1----------------------1-----------------------------1--------111-------------------------------1--111111111112--1-1---1111------------112--------------------------------------------1111111111111311111111121-1------1--------11---------------------------------------------------------------------------------1--1-21-2--2---------1---------------------11-----111-1---1--1-111-111-1-111111---------11111111111-1-1-----111------------------------------112--------------------------2----2212-2121-222------------------------11111111111111---------------------------------------------------------2- ------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPEDDHNSRNWNTLPWHRQWLVKQVEGLFDFFQHRALNPAGGFFDLDAKGAPLQANDPVR:Sequence : TTcHH HHHHHHHHHHHHHHHHGGHGGGEETTEEccccTTcccccGGcEE:Sec Str : ============================================:RP:SCP|17->408|2afaA1|2e-62|38.4|383/407|a.102.1.3 : ==================================================:BL:SWS|11->408|YIHS_ECOLI|6e-70|38.2|390/413 : $$$$$$$$$$$$$$$$$$$:RP:PFM|42->372|PF07221|3e-70|48.9|321/338|GlcNAc_2-epim 61: . . . * . .: 120 :GIHASARMVHCFSIGHLLGRPGCGDIVDHGMTYLWNNHRDGEHGGYFWQVNDAGPVDATK:Sequence :HHHHHHHHHHHHHHHHHHTcTTHHHHHHHHHHHTTTTcEcTTTcccccEEccccEEEccE:Sec Str :============================================================:RP:SCP|17->408|2afaA1|2e-62|38.4|383/407|a.102.1.3 :============================================================:BL:SWS|11->408|YIHS_ECOLI|6e-70|38.2|390/413 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->372|PF07221|3e-70|48.9|321/338|GlcNAc_2-epim 121: . . + . . .: 180 :QGYGHAFVLLAASSAKTVGHPLADQMLADITEVLETRFWEEKHGAIAEEFNRDWSPIDNY:Sequence :EHHHHHHHHHHHHHHHTTTcTTHHHHHHHHHHHHHHHTEETTTTEccccEEcTTcccccc:Sec Str :============================================================:RP:SCP|17->408|2afaA1|2e-62|38.4|383/407|a.102.1.3 :============================================================:BL:SWS|11->408|YIHS_ECOLI|6e-70|38.2|390/413 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->372|PF07221|3e-70|48.9|321/338|GlcNAc_2-epim 181: . * . . . .: 240 :RGQNSNMHLTEALMAAYEATGDSNYLTKAERIADLVIRRRAGELDFRVPEHFDENWTLDK:Sequence :cEEHHHHHHHHHHHHHHHTTccTHHHHHHHHHHHHHcccccGGGTTccccEEcTTccccT:Sec Str :============================================================:RP:SCP|17->408|2afaA1|2e-62|38.4|383/407|a.102.1.3 :============================================================:BL:SWS|11->408|YIHS_ECOLI|6e-70|38.2|390/413 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->372|PF07221|3e-70|48.9|321/338|GlcNAc_2-epim 241: + . . . . *: 300 :AYRGNEMFRPSGSTPGHWLEWARLILQLWVLGERQHDWMPVAAKSLFVQSMALGWDREKG:Sequence :TTcTTccTTcccccHHHHHHHHHHHHHHHTTTccccHHHHHHHHHHHHHHHHHHcccccc:Sec Str :============================================================:RP:SCP|17->408|2afaA1|2e-62|38.4|383/407|a.102.1.3 :============================================================:BL:SWS|11->408|YIHS_ECOLI|6e-70|38.2|390/413 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->372|PF07221|3e-70|48.9|321/338|GlcNAc_2-epim 301: . . . . + .: 360 :GFFYTLDWNDNPDKRAKLWWPMCEAAGAAHFLNENLPADAFYEDSYRRIWSTIANNFIDH:Sequence :ccccccccTTcccccccEEHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHTcT:Sec Str :============================================================:RP:SCP|17->408|2afaA1|2e-62|38.4|383/407|a.102.1.3 :============================================================:BL:SWS|11->408|YIHS_ECOLI|6e-70|38.2|390/413 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->372|PF07221|3e-70|48.9|321/338|GlcNAc_2-epim 361: . . . * . .: 420 :ENGGWHEELTEDLVPAHTLFPGKGDIYHALQACLIPLFPAAGSLTTVIKESGGDY :Sequence :TTcccccEEcTTccccccccccccccTTTHHHHTGGGccccccHHHHH :Sec Str :================================================ :RP:SCP|17->408|2afaA1|2e-62|38.4|383/407|a.102.1.3 :================================================ :BL:SWS|11->408|YIHS_ECOLI|6e-70|38.2|390/413 :$$$$$$$$$$$$ :RP:PFM|42->372|PF07221|3e-70|48.9|321/338|GlcNAc_2-epim