[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK87977.1"

            "conserved hypothetical protein"
            ""

OrgPattern ------------------------1-11-1-1------------------------------------ ----1----------------------------------1--------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1--1111-1--11-------------------------------------------------------------------------------------------------------------------------------------1133332-2222221222221222-11111211233-22222222222223-1---2------1--------1----211-------------------------------11--111121111111111111111111111111131--11211----1112--------11---------1-21----------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111--11------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRLAELSPIGERVTLDTLHFSAEDIIRFARDFDPQPFHLDAEAARNSVFGGLCASGWHTG:Sequence :HHHHHHccTTcEEcccccEccHHHHHHHHHHccccHHHHcHHHHHHHHcccccccHHHHH:Sec Str : =====================================================:RP:SCP|8->147|1q6wA|5e-27|28.7|129/151|d.38.1.4 :============================================================:BL:SWS|1->127|YDEM_BACSU|4e-10|33.9|115/141 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->119|PF01575|1e-08|41.9|93/116|MaoC_dehydratas 61: . . . * . .: 120 :AGWMKSFLSHWAKEVKRLKLQGLEPPKLGPSPGFRELKWKKPVFAGDDVTYFVTLLDARP:Sequence :HHHHHHHTTTTccHHcccccHHHHTTTccEEEEEEcEEccccccTTcEEEEEEEEEEEEE:Sec Str :============================================================:RP:SCP|8->147|1q6wA|5e-27|28.7|129/151|d.38.1.4 :============================================================:BL:SWS|1->127|YDEM_BACSU|4e-10|33.9|115/141 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|11->119|PF01575|1e-08|41.9|93/116|MaoC_dehydratas 121: . . + . . .: 180 :LESRPGIWLNITFNEGVNQSGETVLTFQSGVLEFD :Sequence :ccccTTcEEEEEEEEEEcTTccEEEEEEEEEEEcc :Sec Str :=========================== :RP:SCP|8->147|1q6wA|5e-27|28.7|129/151|d.38.1.4 :======= :BL:SWS|1->127|YDEM_BACSU|4e-10|33.9|115/141