[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK88177.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--111-1-1-111111--------------111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIEYAILFGLGFLTATLLALLIAPAIHRRIVAYTENRIRATMPISPQEVRAQKDMARALY:Sequence : XXXXXXXXXXXXXXX :SEG|7->21|lfglgfltatllall 61: . . . * . .: 120 :AAENAKVRQELDTEREKNTSLRLANEAASSDAYRLGEQNRSFSLKIEELTLEIGELRAAL:Sequence : ===================================================:BL:SWS|70->254|BRE1_NEUCR|9e-07|31.0|168/707 121: . . + . . .: 180 :DASEERAGTIAANLLQQEQAANERASQMSDLTARLTNLTRELDDSKITAATRDLEAEQAK:Sequence : XXXXXXXXXXXXX :SEG|131->143|aanllqqeqaane :============================================================:BL:SWS|70->254|BRE1_NEUCR|9e-07|31.0|168/707 181: . * . . . .: 240 :QTASRFRKEGETATRELQDVAARNKEAMTAVARESRKVTRLEEQLATLMAKNADLDTMLT:Sequence :============================================================:BL:SWS|70->254|BRE1_NEUCR|9e-07|31.0|168/707 241: + . . . . *: 300 :LRNQDVARLREQLAATGGRSNDMIIRLPNPAVPVEKAVNPPQPAAPAPAAALDTAPVVED:Sequence : XXXXXXXXXXXXXXXXXXXX :SEG|277->296|avnppqpaapapaaaldtap :============== :BL:SWS|70->254|BRE1_NEUCR|9e-07|31.0|168/707 301: . . . . + .: 360 :EVTEAMAAEDTVVSPVVERAAPAKEGLEQEIEDIRNQGTALTERLLNVRGTSNDEPIRRE:Sequence : XXXXXX:SEG|355->367|epirreiariaae 361: . . . * . .: 420 :IARIAAEMIALTAAREGERSPIPGLLARASVSSERESLATRAKVVMEKRKR :Sequence :XXXXXXX :SEG|355->367|epirreiariaae