[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK88177.1 atum0 AAK88177.1 "conserved hypothetical protein"
MIEYAILFGLGFLTATLLALLIAPAIHRRIVAYTENRIRATMPISPQEVRAQKDMARALY
AAENAKVRQELDTEREKNTSLRLANEAASSDAYRLGEQNRSFSLKIEELTLEIGELRAAL
DASEERAGTIAANLLQQEQAANERASQMSDLTARLTNLTRELDDSKITAATRDLEAEQAK
QTASRFRKEGETATRELQDVAARNKEAMTAVARESRKVTRLEEQLATLMAKNADLDTMLT
LRNQDVARLREQLAATGGRSNDMIIRLPNPAVPVEKAVNPPQPAAPAPAAALDTAPVVED
EVTEAMAAEDTVVSPVVERAAPAKEGLEQEIEDIRNQGTALTERLLNVRGTSNDEPIRRE
IARIAAEMIALTAAREGERSPIPGLLARASVSSERESLATRAKVVMEKRKR
//