[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK88186.2"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLKKIIAAAICGIAIASMSTHADAAGAAGFARGFAAVEKSAVTAIGISAPGGFDGCVLAA:Sequence : XXXXXXXXXXXX :SEG|5->16|iiaaaicgiaia : XXXXXXXXXXXXXXX :SEG|22->36|adaagaagfargfaa 61: . . . * . .: 120 :GQCVSTIAAPLTVERREELLRVNRDVNATMGALDDYVSGFATDLPATPSVSLGDCGDCAA:Sequence : XXXXXXXXXXXXXXXX :SEG|71->86|ltverreellrvnrdv : $$$$$$$$$$$$$$$$$$:RP:PFM|103->165|PF06035|1e-06|41.3|63/123|DUF920 121: . . + . . .: 180 :IKRTALAGAGWSSNALRLAFALKGDGSLEKVLIVTTDKGDIVLGNATFSPASRETAL :Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|103->165|PF06035|1e-06|41.3|63/123|DUF920