[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK88218.2"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -11-------------------------------------------1---------------------1------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-2111111111-----1-------11111111111-11-1111-111-111222222222-----1-111111-1--------------12------------------------------11111----1111-11-----11-11111---1-2221--11112122111121--1211211-------1-1221---1-----------111------11111--1------------------------------1----1------------------------1-----------------------------------------------------------------------------------------------1------------------------------------11-1-----1----1111-111---------------------------1-11----------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKNGLLDDEKTALTKNTSLSAFVMQSLRDRRQRQNAAPATKDHSFPVIASYNVHKCVGR:Sequence : ccccccccccccTTcccccEEEEEEEEEEEEcHH:Sec Str : ============:RP:SCP|49->275|1vybA|2e-11|15.9|208/236|d.151.1.1 : ====================:BL:SWS|41->274|YBHP_SHIFL|3e-08|30.1|229/253 61: . . . * . .: 120 :DRKFDPDRTSRVIQEIGADIIALQEADSRFGERTGLLDLARLERESGLVPVPVQAGVKAH:Sequence :HHHcHHHHHHHHHHHTTccEEEEEEEccTTGcHHHHHHHHHHTcccTTccEEEEcccccc:Sec Str :============================================================:RP:SCP|49->275|1vybA|2e-11|15.9|208/236|d.151.1.1 :============================================================:BL:SWS|41->274|YBHP_SHIFL|3e-08|30.1|229/253 121: . . + . . .: 180 :GWHGNVVLFREGAVRDVHTLKLPGLEPRGALVVELDLKSGGTLRVIAAHFGLLRHSRAQQ:Sequence :cccEEEEEEcTTTEEEEEEEEccccccEEEEEEETTcccccEEEEEEccccGGGHHHHHH:Sec Str :============================================================:RP:SCP|49->275|1vybA|2e-11|15.9|208/236|d.151.1.1 :============================================================:BL:SWS|41->274|YBHP_SHIFL|3e-08|30.1|229/253 181: . * . . . .: 240 :AKALVGLLEARNECATILMGDLNEWRLGNGSSLNTFRDAFGTLPPAVPSFPSNLPVLALD:Sequence :HHHHHHHHHHHHcccEEEEEEccccTTGGGGcHHHHcTTcEEcccTTccccccccccccE:Sec Str :============================================================:RP:SCP|49->275|1vybA|2e-11|15.9|208/236|d.151.1.1 :============================================================:BL:SWS|41->274|YBHP_SHIFL|3e-08|30.1|229/253 241: + . . . . *: 300 :RIIANREGLIEQVEAHDSALARIASDHLPLKAAIRTDLLPA :Sequence :EEEEEcEccHHHHHTccHHHHHHHcccccEEEEEcc :Sec Str :=================================== :RP:SCP|49->275|1vybA|2e-11|15.9|208/236|d.151.1.1 :================================== :BL:SWS|41->274|YBHP_SHIFL|3e-08|30.1|229/253