[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK88218.2 atum0 AAK88218.2 "conserved hypothetical protein"
MKKNGLLDDEKTALTKNTSLSAFVMQSLRDRRQRQNAAPATKDHSFPVIASYNVHKCVGR
DRKFDPDRTSRVIQEIGADIIALQEADSRFGERTGLLDLARLERESGLVPVPVQAGVKAH
GWHGNVVLFREGAVRDVHTLKLPGLEPRGALVVELDLKSGGTLRVIAAHFGLLRHSRAQQ
AKALVGLLEARNECATILMGDLNEWRLGNGSSLNTFRDAFGTLPPAVPSFPSNLPVLALD
RIIANREGLIEQVEAHDSALARIASDHLPLKAAIRTDLLPA
//