[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK88297.2"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------111---------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1----111111-111-------------------------------------------------------------------------111111-1111111-1111111112222------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPDTHGVGYQKEHGKTTVAINRLDLEKRELDYFHNAGFFHLSGEDFDGLFQHHLAETDPP:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->204|PF08893|7e-53|50.5|204/319|DUF1839 61: . . . * . .: 120 :FLPYTEFAKFADSNPSPAHIRKTAERLLKFHFSRRPSANPVRAFAKVFPAQVEKVADRPF:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->204|PF08893|7e-53|50.5|204/319|DUF1839 121: . . + . . .: 180 :GFFHKYAFNTLRQLGANFELAASHLEWLDKQGFSDARDHALKISEVAKTVQFQLARAVTR:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->204|PF08893|7e-53|50.5|204/319|DUF1839 181: . * . . . .: 240 :RKFDALATVLDPAADAWDGLMESLGEKLSDASEAA :Sequence :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->204|PF08893|7e-53|50.5|204/319|DUF1839