[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK88297.2 atum0 AAK88297.2 "hypothetical protein"
MPDTHGVGYQKEHGKTTVAINRLDLEKRELDYFHNAGFFHLSGEDFDGLFQHHLAETDPP
FLPYTEFAKFADSNPSPAHIRKTAERLLKFHFSRRPSANPVRAFAKVFPAQVEKVADRPF
GFFHKYAFNTLRQLGANFELAASHLEWLDKQGFSDARDHALKISEVAKTVQFQLARAVTR
RKFDALATVLDPAADAWDGLMESLGEKLSDASEAA
//