[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:AAK88391.2"

            "RhtB family transporter"
            ""

OrgPattern ----------------------------1---------11111-------111--------------- ----4211222--------------1------2---1321-1-----1----122------11-117------------------------------------1-----1----------------1-11---1--111-----1----------------------------------------1--------232333132212121-322-1222-332---------5----------------11111----------------------------------------------------------------------------------------------1----------1-----------------444-111-1--533---2212222122221115--11114112A1-69955386455711--11431--1214--------1111-11---------------------------------1--23315899998644446669444443C644354--556-23222-3154--3--1-22----------12--11-415-214--3--2-111-22----1-----1-------1----------1-----33312-2-2122434423433332345335--------------4731162212222222-22222222222222222224344633222122222222222224-11--11--211111111111---1-----1211-15391111-----------7779723111--221234423333322-4---------12457444446574211--------1111---------------------------------------------------------1- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDFVPSLPTLIAFTIAILLLAVTPGPDMTLWISRSLREGRAAGFMTLVGTNIGITVHTML:Sequence : XXXXXXXXXXXXXXXXX :SEG|7->23|lptliaftiailllavt : =====================================:BL:SWS|24->209|Y4757_PSEAE|4e-17|31.9|182/216 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->144|PF01810|7e-20|47.1|119/190|LysE 61: . . . * . .: 120 :VAFGVAALIVASPTAFMILKTGGAAYLVWLAIQAIRKGSDFVMVKSTGEKAQASLKSALL:Sequence :============================================================:BL:SWS|24->209|Y4757_PSEAE|4e-17|31.9|182/216 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->144|PF01810|7e-20|47.1|119/190|LysE 121: . . + . . .: 180 :NGIWVNLLNPKVIIFFMTFLPQFVSATDPHVTGKLIFLGIWSIIVALPIGIGIVVTADIL:Sequence :============================================================:BL:SWS|24->209|Y4757_PSEAE|4e-17|31.9|182/216 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|24->144|PF01810|7e-20|47.1|119/190|LysE 181: . * . . . .: 240 :SAWLQRNRKVLRGLDYTIAGVFSLFAVKIFFTQTR :Sequence :============================= :BL:SWS|24->209|Y4757_PSEAE|4e-17|31.9|182/216