[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL41403.1 atum0 AAL41403.1 "hypothetical protein"
MGRHNKARRLFHSSKAEIRLSLQTRRHVESMHPAPQKSIPIFAPML
//