[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL43181.1 atum0 AAL43181.1 "hypothetical protein"
MTGGLRISGEAALQSFDVVAFKSLSIHSGPEVRGALPPSALPGISPSRGEIDLRQGFALL
DA
//