[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:accD.1"

accD        "acetyl-coenzyme A carboxyl transferase, beta subunit"
            ""

OrgPattern ------11111111111-------1112--11----------------------------------1- 111-2-11111-1-1-111-11--1211111111111322-112111211111111--112211-223231-111111-1113111111112-1--1--11111111221111111111111111213222122122335511-2211111111111111111111111111111111111111121111-122111111111111111112222111222211111111121111111111111111111111-111111-1-221111111111111111111111111111111111111111111111111111111111-11111111111112111111111---12111111121112-1121-11111111111111111111111111111111111111-1111111122111111221222111121111111111111111111111111213--------11------------------1111111122111111111111111111111-1111111122111211111121221331111111111111111112-1-111111121111111111111222221111111111111111111111111111111111111111--------------------1-11111------11111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122122111111111111111111--------------1-1-------------------------11-11-1111111 ------1----1--------------------------------------------------------------------------------------------------------------------------------------------------2--------------1-211------1---3--1--11112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNWITNYVRPRINSMLGRRPEVPENLWIKCPETGEMVFHKDLEDNKWVIPASGYHMKMPA:Sequence : cccccccHHccccccTcHHHHHHHHHHHHHHcccTTcHHHHHHHHHHHHccH:Sec Str : ===================================:RP:SCP|26->287|2f9yB1|6e-70|49.2|256/257|c.14.1.4 :============================================================:BL:SWS|1->288|ACCD_METFK|6e-76|48.3|288/289 61: . . . * . .: 120 :KARLADLFDGGIYEALAQPKVAQDPLKFRDSKKYTDRLRDSRAKTEQEDTILAGVGLLKG:Sequence :HHHHHHHHHHHTHHHHHHHHHcGGGTcccHHHHHTcHHHHGGGHHHHHHHHHHHcccccc:Sec Str :============================================================:RP:SCP|26->287|2f9yB1|6e-70|49.2|256/257|c.14.1.4 :============================================================:BL:SWS|1->288|ACCD_METFK|6e-76|48.3|288/289 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|97->293|PF01039|2e-31|42.2|187/454|Carboxyl_trans 121: . . + . . .: 180 :LKIVAVVHEFQFMAGSLGIAAGEAIVKAFERAISERCPLVMFPASGGARMQEGILSLMQL:Sequence :EEEEEEcGGGGTcccccccTTcccccHHHHHHHHHHccEEEEEccccEEEEEEEEEEccc:Sec Str :============================================================:RP:SCP|26->287|2f9yB1|6e-70|49.2|256/257|c.14.1.4 :============================================================:BL:SWS|1->288|ACCD_METFK|6e-76|48.3|288/289 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|97->293|PF01039|2e-31|42.2|187/454|Carboxyl_trans 181: . * . . . .: 240 :PRTTVAVNMLKEAGMPYIVVLTNPTTGGVTASYAMLGDVHIAEPGAEICFAGKRVIEQTI:Sequence :cccTTcccEEEEEEEcTTcccEEEEETTEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEE:Sec Str :============================================================:RP:SCP|26->287|2f9yB1|6e-70|49.2|256/257|c.14.1.4 :============================================================:BL:SWS|1->288|ACCD_METFK|6e-76|48.3|288/289 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|97->293|PF01039|2e-31|42.2|187/454|Carboxyl_trans 241: + . . . . *: 300 :REKLPEGFQTSEYLLEHGMVDMVIDRREIPDTLASMLKIMTKAPADNANAVVPLAASA :Sequence :EEEcccccTTcHHHHHHHHHHHHTTHHHHccTHHHHHHHHHHccccTTccc :Sec Str :=============================================== :RP:SCP|26->287|2f9yB1|6e-70|49.2|256/257|c.14.1.4 :================================================ :BL:SWS|1->288|ACCD_METFK|6e-76|48.3|288/289 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|97->293|PF01039|2e-31|42.2|187/454|Carboxyl_trans