[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK85845.1 atum0 accD.1 "acetyl-coenzyme A carboxyl transferase, beta subunit"
MNWITNYVRPRINSMLGRRPEVPENLWIKCPETGEMVFHKDLEDNKWVIPASGYHMKMPA
KARLADLFDGGIYEALAQPKVAQDPLKFRDSKKYTDRLRDSRAKTEQEDTILAGVGLLKG
LKIVAVVHEFQFMAGSLGIAAGEAIVKAFERAISERCPLVMFPASGGARMQEGILSLMQL
PRTTVAVNMLKEAGMPYIVVLTNPTTGGVTASYAMLGDVHIAEPGAEICFAGKRVIEQTI
REKLPEGFQTSEYLLEHGMVDMVIDRREIPDTLASMLKIMTKAPADNANAVVPLAASA
//