[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:argB"

argB        "acetylglutamate kinase"
ARGB_AGRT5  "RecName: Full=Acetylglutamate kinase;         EC=2.7.2.8;AltName: Full=NAG kinase;         Short=AGK;AltName: Full=N-acetyl-L-glutamate 5-phosphotransferase;"

OrgPattern 11-1--1111111111-11111111--111-11111111111111111111111-11-1--1--1-11 1111211111111111111-111111111111111111111111111-1111111111--111111111111111111--11-11111111111---111-1-1111111---------------11111111111222221112111111111111111111111111111111111111112221111-111111111111111111111111111111111111111111-11111111111111-11-1-------1---11-------11-111-------111------------------------1--111----11-11-------1-111111---1-1--111111111111-111111--1121111111111111111111111111111111111-11111111111-111111111111111111111111111111111111111111111111111--111-11-1111-11-111111111121222223332222222222222222222222222222222222222222222222232222222222222-12111111111111111111111222212111-11111111--1-------1111122222222212122222222222222222222---22222--22221222222222222222-2222222222222222222222222222222222222222222222222221-222222222222---1---------211222222-22-------2222222222222222222222222222221--------222222222222222111111111111111111111111-------------------------------------11--11111221 ----11--------111-1111112-11111111111111111111-1121111--11111111111111111111111111111111-12111122111121121-12------------------------------------------------------------------21117111214255-141121211 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTSSESEIQARLLAQALPFMQKYENKTIVVKYGGHAMGDSTLGKAFAEDIALLKQSGINP:Sequence :cccTcHHHHHHHHHHHHHHHHHHTTcEEEEEEcTHHHTcHHHHHHHHHHHHHHHTTTcEE:Sec Str : ===================================:RP:SCP|26->293|1gs5A|9e-87|30.8|253/259|c.73.1.2 :============================================================:BL:SWS|1->294|ARGB_AGRT5|e-164|100.0|294/294 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->264|PF00696|3e-15|35.6|219/244|AA_kinase 61: . . . * . .: 120 :IVVHGGGPQIGAMLSKMGIESKFEGGLRVTDAKTVEIVEMVLAGSINKEIVALINQTGEW:Sequence :EEEEcccHHHHHHHHHHTcccccccccccccHHHHHHHHHHHHHTHHHHHHHHHTTcccc:Sec Str :============================================================:RP:SCP|26->293|1gs5A|9e-87|30.8|253/259|c.73.1.2 :============================================================:BL:SWS|1->294|ARGB_AGRT5|e-164|100.0|294/294 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->264|PF00696|3e-15|35.6|219/244|AA_kinase 121: . . + . . .: 180 :AIGLCGKDGNMVFAEKAKKTVIDPDSNIERVLDLGFVGEVVEVDRTLLDLLAKSEMIPVI:Sequence :EEEEETTGGGcEEEEEcccccccccccccEEcccccEEEEEEEcHHHHHHHHTTTcEEEE:Sec Str :============================================================:RP:SCP|26->293|1gs5A|9e-87|30.8|253/259|c.73.1.2 :============================================================:BL:SWS|1->294|ARGB_AGRT5|e-164|100.0|294/294 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->264|PF00696|3e-15|35.6|219/244|AA_kinase 181: . * . . . .: 240 :APVAPGRDGATYNINADTFAGAIAGALHATRLLFLTDVPGVLDKNKELIKELTVSEARAL:Sequence :EcEEEcTTccEEEEcHHHHHHHHHHHTTccEEEEEEccccEETTTTcTTcEEcEEEHHHH:Sec Str :============================================================:RP:SCP|26->293|1gs5A|9e-87|30.8|253/259|c.73.1.2 :============================================================:BL:SWS|1->294|ARGB_AGRT5|e-164|100.0|294/294 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->264|PF00696|3e-15|35.6|219/244|AA_kinase 241: + . . . . *: 300 :IKDGTISGGMIPKVETCIDAIKAGVQGVVILNGKTPHSVLLEIFTEGAGTLIVP :Sequence :HHHGGGccTTHHHHHHHHHHHHHTccEEEEEETTcTTHHHHHHHcccccEEEEc :Sec Str :===================================================== :RP:SCP|26->293|1gs5A|9e-87|30.8|253/259|c.73.1.2 :====================================================== :BL:SWS|1->294|ARGB_AGRT5|e-164|100.0|294/294 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|28->264|PF00696|3e-15|35.6|219/244|AA_kinase