[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK86197.1 atum0 argB "acetylglutamate kinase"
MTSSESEIQARLLAQALPFMQKYENKTIVVKYGGHAMGDSTLGKAFAEDIALLKQSGINP
IVVHGGGPQIGAMLSKMGIESKFEGGLRVTDAKTVEIVEMVLAGSINKEIVALINQTGEW
AIGLCGKDGNMVFAEKAKKTVIDPDSNIERVLDLGFVGEVVEVDRTLLDLLAKSEMIPVI
APVAPGRDGATYNINADTFAGAIAGALHATRLLFLTDVPGVLDKNKELIKELTVSEARAL
IKDGTISGGMIPKVETCIDAIKAGVQGVVILNGKTPHSVLLEIFTEGAGTLIVP
//