[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:bacA.1"

bacA        "undecaprenyl pyrophosphate phosphatase, possible bacitracin resistance protein"
UPPP1_AGRT5  "RecName: Full=Undecaprenyl-diphosphatase 1;         EC=3.6.1.27;AltName: Full=Undecaprenyl pyrophosphate phosphatase 1;AltName: Full=Bacitracin resistance protein 1;"

OrgPattern --------------------------------11---111111---------------------1--- -11--11111121211111-11111111111111111-1-12221111111-11111111--11-112111111111111111111111111-111---11111111111--------------111-1111-1-111111---1--1-1111----------11-1-11-1---11111-11111111111113333433424344432211114441112112------22111111111111111111111--11111---11--111--11111111111111111111111111111111111111111111111111111212222222121122211111111111111112111111111111111111111-----1-1111111111111111111111-11111111111112211111111112--1--11111---1111111111111111-----------------------------11111111111222222211112222222222222211111111111112111111111111211111111111111111111111111111212-11211--1--11111-11111111---------111-1111111111112111111111111112111111-1-11111-11111111111111111111-11111111111111111111111111-1111111111111111111-11111-111111111111-1-1---------11112---------------11111121111111111121111111111---------11111111111111111111111111111-111111111--------1---------------------------11111-1---111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGDQSIISALLLGIIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFAVLIQLGAILAILL:Sequence : XXXXXXXXXXXXXX:SEG|47->60|avliqlgailaill :============================================================:BL:SWS|1->253|UPPP1_AGRT5|e-119|100.0|253/268 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->253|PF02673|6e-31|39.5|243/254|BacA 61: . . . * . .: 120 :VYFQKLVSIAVAMPTSAKARRFVLAVLVAFLPAAVIGALAHDFIKTVLFETPMLICVVLI:Sequence : XXXXXXXXXXXXXXXXXXX :SEG|77->95|akarrfvlavlvaflpaav :============================================================:BL:SWS|1->253|UPPP1_AGRT5|e-119|100.0|253/268 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->253|PF02673|6e-31|39.5|243/254|BacA 121: . . + . . .: 180 :IGGFILLAVDRMPLKPKYTDIMDYPPSLAFKIGLFQCLAMIPGTSRSGATIVGALLMGTD:Sequence :============================================================:BL:SWS|1->253|UPPP1_AGRT5|e-119|100.0|253/268 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->253|PF02673|6e-31|39.5|243/254|BacA 181: . * . . . .: 240 :KRSAAEFSFFLAMPTMLGAFVLDLYKNRDALSFDDSALIAVGFVAAFVSGLFVVRSLLDF:Sequence :============================================================:BL:SWS|1->253|UPPP1_AGRT5|e-119|100.0|253/268 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->253|PF02673|6e-31|39.5|243/254|BacA 241: + . . . . *: 300 :VSRRGFAPFAWWRIVIGALGLVALLVIG :Sequence : XXXXXXXXXXXXXX :SEG|254->267|ivigalglvallvi :============= :BL:SWS|1->253|UPPP1_AGRT5|e-119|100.0|253/268 :$$$$$$$$$$$$$ :RP:PFM|9->253|PF02673|6e-31|39.5|243/254|BacA