[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK86109.1 atum0 bacA.1 "undecaprenyl pyrophosphate phosphatase, possible bacitracin resistance protein"
MGDQSIISALLLGIIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFAVLIQLGAILAILL
VYFQKLVSIAVAMPTSAKARRFVLAVLVAFLPAAVIGALAHDFIKTVLFETPMLICVVLI
IGGFILLAVDRMPLKPKYTDIMDYPPSLAFKIGLFQCLAMIPGTSRSGATIVGALLMGTD
KRSAAEFSFFLAMPTMLGAFVLDLYKNRDALSFDDSALIAVGFVAAFVSGLFVVRSLLDF
VSRRGFAPFAWWRIVIGALGLVALLVIG
//