[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:cbiC"

cbiC        "precorrin-8X methylmutase"
            ""

OrgPattern -------111111111--1-1--1----1--1111111111111111111111--------111--11 ---11-1-----1-11111-11--1111111111111111-111----------------11111111111----------11-----11-1-111---------1-------------------11-1-----1111111-----12112211111111--1-11111221111111111-111-11----1-------------------------1111----11---1----------------------------------11---------------------------------------------1----------11-111111111111111111111----111111111--1111----11------------11111---1111111111111111-21111111-1--11111111111111---111111111111111111----11-1-------------------------------1--------111111111111111111111111--------1-21--111-1---1----1------------11-11-1-11111111-111111112-----1-1-----------------------------1-------------------------1------1-------1------------------------------------111--11---------------------------1------------------------1-1-1---------------------------1111111111111-111---------------------1------------------1---1111--------1------------------------------11-------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTDYDYIRDGNAIYERSFAIIREEADLSAFTEEQADIAIRMIHACGQVEAAGHFRFSPDF:Sequence : cccccccHHHHHHHHHHHHHHHcccTTccHHHHHHHHHHHHHHTcGGGGGGEEEcTTH:Sec Str : ==========================================================:RP:SCP|3->210|1f2vA|2e-75|72.1|208/209|c.23.17.1 :============================================================:BL:SWS|1->210|COBH_PSEDE|3e-84|71.9|210/210 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->205|PF02570|4e-39|54.5|187/197|CbiC 61: . . . * . .: 120 :VSAARGALLAGKPVLCDAQMVAHGVTHARLPADNAVICTLRDPRTPELAKNIGNTRSAAA:Sequence :HHHHHHHHHTTccEEEccHHHHHHccGGGccccccEEccTTcTTHHHHHHHHTccHHHHG:Sec Str : XXX:SEG|118->132|aaaldlwadyldgal :============================================================:RP:SCP|3->210|1f2vA|2e-75|72.1|208/209|c.23.17.1 :============================================================:BL:SWS|1->210|COBH_PSEDE|3e-84|71.9|210/210 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->205|PF02570|4e-39|54.5|187/197|CbiC 121: . . + . . .: 180 :LDLWADYLDGALVAIGNAPTALFYLLEMLEKGGPRPAAIIGMPVGFVGAAESKDALEASA:Sequence :GGGGGGGcTTcEEEEcccHHHHHHHHHHHHTTcccccEEEEcccccccHHHHHHHHHHcc:Sec Str :XXXXXXXXXXXX :SEG|118->132|aaaldlwadyldgal :============================================================:RP:SCP|3->210|1f2vA|2e-75|72.1|208/209|c.23.17.1 :============================================================:BL:SWS|1->210|COBH_PSEDE|3e-84|71.9|210/210 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->205|PF02570|4e-39|54.5|187/197|CbiC 181: . * . . . .: 240 :LGIPYAIVKGRLGGSAMTAAAINAVARAGL :Sequence :TTccEEEEccccccHHHHHHHHHHHHcccc :Sec Str :============================== :RP:SCP|3->210|1f2vA|2e-75|72.1|208/209|c.23.17.1 :============================== :BL:SWS|1->210|COBH_PSEDE|3e-84|71.9|210/210 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|17->205|PF02570|4e-39|54.5|187/197|CbiC