[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:cfa.1"

cfa         "cyclopropane-fatty-acyl-phospholipid synthase"
            ""

OrgPattern -------------------------------------------------------------------- 1---41--111121388AA-A555B8A9AAA867771454-333---------23--2--112--121131-111111-----11----------------------------------------22-222111-2111-------1------12-----------2--1-------------111--------111111-21-21--2------1-------------------------------------11211111111221111111111-11111----------------------------------111-------121111111-1--1221111-1----------------------------2224-----112331113222211-11111112---1--1--242-2334122322222211111111111121111111151111-22-----------------------------222321211-11111115111133312222123231211-11231234242221132121-322----------121-121131-1----------121-111-1-3111----11111-1-1111111-----1111-121121111111111-111111--1-1----222------11132221111111111-111111111111111111122222111111111111111111121111111--111111111111---3-----111122221---------------22--2-211111111132222222221221-1-11-1---11111111111113322222222--------22----------------------------------------------------- ----131-2---2333333211133331111111111111-11-11552222523331233311111111--111------11111---48532561113123111-12-2----------------------------------------------------21------112-2222E22212322B3642142112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MASSLHVLLEKIIKIGDLTVNSPGGSRTFGDGTGKKVVLNFTDEAAMQEIAADPALKLAE:Sequence : HHHHHHccHHHHHHHHTccHHHHHHH:Sec Str 61: . . . * . .: 120 :MYMEGRAKVAKGDIYDFLALVKGNTLSEALSFGMIWRGMARIIAARIKMRLPVNHNKSNV:Sequence :HHHHHHHHHHHTcEEETTEEEEcHHHHHHHHcHHHHHHHHHHHHTTHHHHTTEEEEEEET:Sec Str : =:BL:SWS|120->384|YLP3_PSEPU|9e-55|40.9|264/394 : $$$$:RP:PFM|117->380|PF02353|4e-71|51.9|262/271|CMAS 121: . . + . . .: 180 :AHHYDLSAKLFDLFLDEDWQYSCAYFNPPDIGLYEAQVAKKRHIAAKLMTEPGQSVLEIG:Sequence :ccccHHHHHHHHHHHHHHHHHccccccEEEEEEEccTTccHHHHHHTHHHHHHHHHHHHc:Sec Str : =======================================================:RP:SCP|126->384|1kp9A|2e-80|35.4|257/270|c.66.1.18 :============================================================:BL:SWS|120->384|YLP3_PSEPU|9e-55|40.9|264/394 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|117->380|PF02353|4e-71|51.9|262/271|CMAS 181: . * . . . .: 240 :SGWGGMAMYIAESAGADVTGITLSEEQLRVSRDRAAKRGLAGNVRFELQDYRYLPASKKY:Sequence :ccTTcEEEEEccccTTcccccTTcEEEEEEEccTTccccccGTcccTTcTTcccccccTT:Sec Str :============================================================:RP:SCP|126->384|1kp9A|2e-80|35.4|257/270|c.66.1.18 :============================================================:BL:SWS|120->384|YLP3_PSEPU|9e-55|40.9|264/394 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|117->380|PF02353|4e-71|51.9|262/271|CMAS 241: + . . . . *: 300 :DRIVSVGMFEHVGPTHYRDYFDKVAEVLDDKGVMVLHSIGQPYPALATNPFIEKYIFPGG:Sequence :ccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEEEccccTTccccTTTTcccccc:Sec Str :============================================================:RP:SCP|126->384|1kp9A|2e-80|35.4|257/270|c.66.1.18 :============================================================:BL:SWS|120->384|YLP3_PSEPU|9e-55|40.9|264/394 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|117->380|PF02353|4e-71|51.9|262/271|CMAS 301: . . . . + .: 360 :YIPSLAEVLPAIQKSGLLVKDIEILPMHYAHTLRHWRERFVARKAEAVALYDERFFRMWE:Sequence :cccHHHHHHHHHHHccEEEEEEEEEEEETTTTcccTHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|126->384|1kp9A|2e-80|35.4|257/270|c.66.1.18 :============================================================:BL:SWS|120->384|YLP3_PSEPU|9e-55|40.9|264/394 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|117->380|PF02353|4e-71|51.9|262/271|CMAS 361: . . . * . .: 420 :FYLAGSEMAFTHENFHIFQIQLAKDRDAVPHNRDYIAQNEAKLLEFEKTRPPLEKVSF :Sequence :HHGGGTccEEEEccEEEEEEEEEETccccccEEEEEEEcccHHHHTcccccccccccE :Sec Str :======================== :RP:SCP|126->384|1kp9A|2e-80|35.4|257/270|c.66.1.18 :======================== :BL:SWS|120->384|YLP3_PSEPU|9e-55|40.9|264/394 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|117->380|PF02353|4e-71|51.9|262/271|CMAS