[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:cheD.1"

cheD        "methyl-accepting chemotaxis protein"
CHED_AGRT5  "RecName: Full=Probable chemoreceptor glutamine deamidase cheD;         EC=3.5.1.44;"

OrgPattern -----------------------11-11-1-----1--1111111-11-1212-1-1-11-------- 1-----------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------111---------------1111-1---1111111------11------------------------------------------------------------------------------------------11111111111111111111---111---1121111111211111111-----1111-----11-11-------1------------------------111211111111--1---1-111111---------111----1----------------------------------1111111111111111111111112121111111--111211111--211111111121-------11--1313-1-11--11--1-3131322-11111-1111-------------------1------1--1-1-----11111---111-12---11-----1---------------------------------------------------------------------------------------------------------2-1---------------------------1111-----------11---------1----11111---111111111111------1122111111111111----------------------------1--1111111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMEAAAKRVHIIQGEYKVVSDPDVVMTTILGSCVAACLRDPVAGLGGMNHFLLPGTGNVT:Sequence : TcEEEEETTcEEEEEEEcccEEEEEEETTTTEEEEEEEccccccccc:Sec Str : ====================================================:RP:SCP|9->148|2f9zC1|4e-33|39.6|139/152|d.194.1.3 :============================================================:BL:SWS|1->181|CHED_AGRT5|e-103|100.0|181/181 : $$$$$$$$$:RP:PFM|52->146|PF03975|3e-25|54.7|95/112|CheD 61: . . . * . .: 120 :GGDATRYGVHLMELLINGLLKQGARRDRLEAKVFGGAKTIASFSNVGEQNAIFAMQFLKD:Sequence :ccGG GcHHHHHHHHHHHHHTTTccGGGcEEEEEEccccccccccHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|9->148|2f9zC1|4e-33|39.6|139/152|d.194.1.3 :============================================================:BL:SWS|1->181|CHED_AGRT5|e-103|100.0|181/181 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->146|PF03975|3e-25|54.7|95/112|CheD 121: . . + . . .: 180 :EGIPVISSSTGGDHGRKIEFWPVSGRARQHPLSGAETQKTVAMETRPVPAPKPVANDIEF:Sequence :TTccEEEEEEcccccEEEEE :Sec Str :============================ :RP:SCP|9->148|2f9zC1|4e-33|39.6|139/152|d.194.1.3 :============================================================:BL:SWS|1->181|CHED_AGRT5|e-103|100.0|181/181 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|52->146|PF03975|3e-25|54.7|95/112|CheD 181: . * . . . .: 240 :F :Sequence : :Sec Str := :BL:SWS|1->181|CHED_AGRT5|e-103|100.0|181/181