[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK86335.1 atum0 cheD.1 "methyl-accepting chemotaxis protein"
MMEAAAKRVHIIQGEYKVVSDPDVVMTTILGSCVAACLRDPVAGLGGMNHFLLPGTGNVT
GGDATRYGVHLMELLINGLLKQGARRDRLEAKVFGGAKTIASFSNVGEQNAIFAMQFLKD
EGIPVISSSTGGDHGRKIEFWPVSGRARQHPLSGAETQKTVAMETRPVPAPKPVANDIEF
F
//